Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.88kD).)

Mouse anti-Human PHIP Monoclonal Antibody | anti-PHIP antibody

PHIP (WDR11, PH-interacting Protein, IRS-1 PH Domain-binding Protein, WD Repeat-containing Protein 11, FLJ20705, FLJ45918, MGC90216) APC

Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PHIP; Monoclonal Antibody; PHIP (WDR11; PH-interacting Protein; IRS-1 PH Domain-binding Protein; WD Repeat-containing Protein 11; FLJ20705; FLJ45918; MGC90216) APC; anti-PHIP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4D7
Specificity
Recognizes human PHIP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1821
Applicable Applications for anti-PHIP antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1599-1706 from human PHIP (NP_060404) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TLSKSSAVIEQGDCKNNALVPGTIQVNGHGGQPSKLVKRGPGRKPKVEVNTNSGEIIHKKRGRKPKKLQYAKPEDLEQNNVHPIRDEVLPSSTCNFLSETNNVKEDL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.88kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.88kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PHIP on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PHIP on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-PHIP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
PH-interacting protein
UniProt Protein Name
PH-interacting protein
Protein Family
UniProt Gene Name
PHIP
UniProt Synonym Gene Names
WDR11; PHIP
UniProt Entry Name
PHIP_HUMAN

Uniprot Description

PHIP: Probable regulator of the insulin and insulin-like growth factor signaling pathways. Stimulates cell proliferation through regulation of cyclin transcription and has an anti- apoptotic activity through AKT1 phosphorylation and activation. Plays a role in the regulation of cell morphology and cytoskeletal organization. Interacts with IRS1 and IRS2. Interacts (via bromo domain) with acetylated lysine residues on histone H1.4, histone H3 and H4 (in vitro)

Chromosomal Location of Human Ortholog: 6q14

Cellular Component: nucleus

Molecular Function: protein binding; insulin receptor binding

Biological Process: positive regulation of insulin-like growth factor receptor signaling pathway; regulation of cell shape; regulation of protein amino acid phosphorylation; positive regulation of mitosis; protein import into nucleus; regulation of growth; positive regulation of transcription, DNA-dependent; positive regulation of cell proliferation; insulin receptor signaling pathway; regulation of cell morphogenesis; cytoskeleton organization and biogenesis; positive regulation of transcription from RNA polymerase II promoter; positive regulation of peptidyl-serine phosphorylation; negative regulation of apoptosis

Similar Products

Product Notes

The PHIP phip (Catalog #AAA6138219) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PHIP (WDR11, PH-interacting Protein, IRS-1 PH Domain-binding Protein, WD Repeat-containing Protein 11, FLJ20705, FLJ45918, MGC90216) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PHIP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PHIP phip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PHIP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.