Testing Data
(Detection limit for recombinant GST tagged OPRL1 is ~3ng/ml as a capture antibody.)
Mouse anti-Human Nociceptin Receptor Monoclonal Antibody | anti-OPRL1 antibody
Nociceptin Receptor (Kappa-type 3 Opioid Receptor, KOR-3, Orphanin FQ Receptor, OPRL1, OOR, ORL1) APC
Gene Names
OPRL1; NOP; OOR; NOPr; ORL1; KOR-3; NOCIR
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Nociceptin Receptor; Monoclonal Antibody; Nociceptin Receptor (Kappa-type 3 Opioid Receptor; KOR-3; Orphanin FQ Receptor; OPRL1; OOR; ORL1) APC; anti-OPRL1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A11
Specificity
Recognizes human OPRL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-OPRL1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa110-213 from human OPRL1 (AAH38433) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPTPQDYWG
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged OPRL1 is ~3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged OPRL1 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-OPRL1 antibody
The protein encoded by this gene is a G protein-coupled receptor whose expression can be induced by phytohemagglutinin. The encoded integral membrane protein is a receptor for the 17aa neuropeptide nociceptin/orphanin FQ. This gene may be involved in the regulation of numerous brain activities, particularly instinctive and emotional behaviors. A promoter for this gene also functions as a promoter for another gene, regulator of G-protein signalling 19 (RGS19), located on the opposite strand. Two transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-OPRL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
40,048 Da
NCBI Official Full Name
Homo sapiens opiate receptor-like 1, mRNA
NCBI Official Synonym Full Names
opioid related nociceptin receptor 1
NCBI Official Symbol
OPRL1
NCBI Official Synonym Symbols
NOP; OOR; NOPr; ORL1; KOR-3; NOCIR
NCBI Protein Information
nociceptin receptor
Protein Family
NCBI Description
The protein encoded by this gene is a member of the 7 transmembrane-spanning G protein-coupled receptor family, and functions as a receptor for the endogenous, opioid-related neuropeptide, nociceptin/orphanin FQ. This receptor-ligand system modulates a variety of biological functions and neurobehavior, including stress responses and anxiety behavior, learning and memory, locomotor activity, and inflammatory and immune responses. A promoter region between this gene and the 5'-adjacent RGS19 (regulator of G-protein signaling 19) gene on the opposite strand functions bi-directionally as a core-promoter for both genes, suggesting co-operative transcriptional regulation of these two functionally related genes. Alternatively spliced transcript variants have been described for this gene. A recent study provided evidence for translational readthrough in this gene and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon. [provided by RefSeq, Jan 2016]
Research Articles on OPRL1
Similar Products
Product Notes
The OPRL1 (Catalog #AAA6137912) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Nociceptin Receptor (Kappa-type 3 Opioid Receptor, KOR-3, Orphanin FQ Receptor, OPRL1, OOR, ORL1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Nociceptin Receptor can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the OPRL1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Nociceptin Receptor, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
