Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human MSK1 Monoclonal Antibody | anti-MSK1 antibody

MSK1 (Ribosomal Protein S6 Kinase alpha-5, S6K-alpha-5, 90kD Ribosomal Protein S6 Kinase 5, Nuclear Mitogen- and Stress-activated Protein Kinase 1, RSK-like Protein Kinase, RSKL, RPS6KA5) APC

Gene Names
RPS6KA5; MSK1; RLPK; MSPK1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MSK1; Monoclonal Antibody; MSK1 (Ribosomal Protein S6 Kinase alpha-5; S6K-alpha-5; 90kD Ribosomal Protein S6 Kinase 5; Nuclear Mitogen- and Stress-activated Protein Kinase 1; RSK-like Protein Kinase; RSKL; RPS6KA5) APC; anti-MSK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b, lambda
Clone Number
2B11
Specificity
Recognizes human RPS6KA5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-MSK1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa271-370 from RPS6KA5 (AAH17187) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ILKSEPPYPQEMSALAKDLIQRLLMKDPKKRLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYSPAALPQSSEK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of RPS6KA5 expression in transfected 293T cell line by RPS6KA5 monoclonal antibody Lane 1: RPS6KA5 transfected lysate (89.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RPS6KA5 expression in transfected 293T cell line by RPS6KA5 monoclonal antibody Lane 1: RPS6KA5 transfected lysate (89.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between NR4A1 and RPS6KA5 HeLa cells were stained with NR4A1 rabbit purified polyclonal 1:1200 and RPS6KA5 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between NR4A1 and RPS6KA5 HeLa cells were stained with NR4A1 rabbit purified polyclonal 1:1200 and RPS6KA5 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-MSK1 antibody
MSK1 is a dual kinase domain protein that acts downstream of the ERK1/2 and p38 MAPK signalling pathways. MSK1 phosphorylate the transcription factors CREB and ATF1, and the chromatin proteins histone H3 and HMGN1 in response to either mitogenic stimulation or cellular stress. MSK1 activity is tightly regulated in cells, and activation requires its phosphorylation by either ERK1/2 or p38alpha. This result in activation of the C-terminal kinase domain, which then phosphorylates further sites in MSK1, leading to the activation of the N-terminal kinase domain and phosphorylation of substrates. The protein contains two complete nonidentical protein kinase domains. The protein is widely expressed in human brain, heart, and placenta. Human MSK1 gene is mapped to chromosomal region 14q31-q32.1.
Product Categories/Family for anti-MSK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
81,780 Da
NCBI Official Full Name
Homo sapiens ribosomal protein S6 kinase, 90kDa, polypeptide 5, mRNA
NCBI Official Synonym Full Names
ribosomal protein S6 kinase A5
NCBI Official Symbol
RPS6KA5
NCBI Official Synonym Symbols
MSK1; RLPK; MSPK1
NCBI Protein Information
ribosomal protein S6 kinase alpha-5

Research Articles on MSK1

Similar Products

Product Notes

The MSK1 (Catalog #AAA6137703) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MSK1 (Ribosomal Protein S6 Kinase alpha-5, S6K-alpha-5, 90kD Ribosomal Protein S6 Kinase 5, Nuclear Mitogen- and Stress-activated Protein Kinase 1, RSK-like Protein Kinase, RSKL, RPS6KA5) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MSK1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MSK1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MSK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.