Mouse anti-Human MSK1 Monoclonal Antibody | anti-MSK1 antibody

MSK1 (Ribosomal Protein S6 Kinase alpha-5, S6K-alpha-5, 90kD Ribosomal Protein S6 Kinase 5, Nuclear Mitogen- and Stress-activated Protein Kinase 1, RSK-like Protein Kinase, RSKL, RPS6KA5) (Biotin)

Cat. Num. AAA6143006

• Gene Names: RPS6KA5; MSK1; RLPK; MSPK1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MSK1; Monoclonal Antibody; MSK1 (Ribosomal Protein S6 Kinase alpha-5; S6K-alpha-5; 90kD Ribosomal Protein S6 Kinase 5; Nuclear Mitogen- and Stress-activated Protein Kinase 1; RSK-like Protein Kinase; RSKL; RPS6KA5) (Biotin); anti-MSK1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b, lambda
• Clone Number: 2B11
• Specificity: Recognizes human RPS6KA5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-MSK1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa271-370 from RPS6KA5 (AAH17187) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ILKSEPPYPQEMSALAKDLIQRLLMKDPKKRLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYSPAALPQSSEK
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of RPS6KA5 expression in transfected 293T cell line by RPS6KA5 monoclonal antibody Lane 1: RPS6KA5 transfected lysate (89.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between NR4A1 and RPS6KA5 HeLa cells were stained with NR4A1 rabbit purified polyclonal 1:1200 and RPS6KA5 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-MSK1 antibody

MSK1 is a dual kinase domain protein that acts downstream of the ERK1/2 and p38 MAPK signalling pathways. MSK1 phosphorylate the transcription factors CREB and ATF1, and the chromatin proteins histone H3 and HMGN1 in response to either mitogenic stimulation or cellular stress. MSK1 activity is tightly regulated in cells, and activation requires its phosphorylation by either ERK1/2 or p38alpha. This result in activation of the C-terminal kinase domain, which then phosphorylates further sites in MSK1, leading to the activation of the N-terminal kinase domain and phosphorylation of substrates. The protein contains two complete nonidentical protein kinase domains. The protein is widely expressed in human brain, heart, and placenta. Human MSK1 gene is mapped to chromosomal region 14q31-q32.1.

Product Categories/Family for anti-MSK1 antibody

Antibodies; Protein Kinases; Ribosomal

NCBI and Uniprot Product Information

• NCBI GI #: 33869498
• NCBI GeneID: 9252
• Molecular Weight: 81,780 Da
• NCBI Official Full Name: Homo sapiens ribosomal protein S6 kinase, 90kDa, polypeptide 5, mRNA
• NCBI Official Synonym Full Names: ribosomal protein S6 kinase A5
• NCBI Official Symbol: RPS6KA5
• NCBI Official Synonym Symbols: MSK1; RLPK; MSPK1
• NCBI Protein Information: ribosomal protein S6 kinase alpha-5