Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.29kD).)

Mouse anti-Human IL10 Monoclonal Antibody | anti-IL10 antibody

IL10 (Interleukin-10, Interleukin 10, Cytokine Synthesis Inhibitory Factor) APC

Gene Names
IL10; CSIF; TGIF; GVHDS; IL-10; IL10A
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL10; Monoclonal Antibody; IL10 (Interleukin-10; Interleukin 10; Cytokine Synthesis Inhibitory Factor) APC; anti-IL10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
1C10
Specificity
Recognizes human IL10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
178
Applicable Applications for anti-IL10 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~10ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa74-178 from human IL10 (AAI04253.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.29kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.29kD).)

Western Blot (WB)

(Western Blot analysis of IL10 expression in transfected 293T cell line by IL10 monoclonal antibody. Lane 1: IL10 transfected lysate (20.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IL10 expression in transfected 293T cell line by IL10 monoclonal antibody. Lane 1: IL10 transfected lysate (20.5kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-IL10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Interleukin 10
NCBI Official Synonym Full Names
interleukin 10
NCBI Official Symbol
IL10
NCBI Official Synonym Symbols
CSIF; TGIF; GVHDS; IL-10; IL10A
NCBI Protein Information
interleukin-10
Protein Family

NCBI Description

The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. Mutations in this gene are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis.[provided by RefSeq, May 2011]

Research Articles on IL10

Similar Products

Product Notes

The IL10 (Catalog #AAA6137139) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IL10 (Interleukin-10, Interleukin 10, Cytokine Synthesis Inhibitory Factor) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Sandwich ELISA: The detection limit is ~10ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.