Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human HSD17B8 Monoclonal Antibody | anti-HSD17B8 antibody

HSD17B8 (Estradiol 17-beta-dehydrogenase 8, 17-beta-hydroxysteroid Dehydrogenase 8, 17-beta-HSD 8, 3-oxoacyl-[acyl-carrier-protein] Reductase, Protein Ke6, Ke-6, Really Interesting New Gene 2 Protein, Testosterone 17-beta-dehydrogenase 8, FABGL, HKE6, RIN

Gene Names
HSD17B8; KE6; FABG; HKE6; FABGL; RING2; H2-KE6; SDR30C1; D6S2245E; dJ1033B10.9
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HSD17B8; Monoclonal Antibody; HSD17B8 (Estradiol 17-beta-dehydrogenase 8; 17-beta-hydroxysteroid Dehydrogenase 8; 17-beta-HSD 8; 3-oxoacyl-[acyl-carrier-protein] Reductase; Protein Ke6; Ke-6; Really Interesting New Gene 2 Protein; Testosterone 17-beta-dehydrogenase 8; FABGL; HKE6; RIN; anti-HSD17B8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4F1
Specificity
Recognizes human HSD17B8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-HSD17B8 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa28-128 from HSD17B8 (NP_055049) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVN*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(HSD17B8 monoclonal antibody Western Blot analysis of HSD17B8 expression in human pancreas.)

Western Blot (WB) (HSD17B8 monoclonal antibody Western Blot analysis of HSD17B8 expression in human pancreas.)

Testing Data

(Detection limit for recombinant GST tagged HSD17B8 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HSD17B8 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-HSD17B8 antibody
NAD-dependent 17-beta-hydroxysteroid dehydrogenase with highest activity towards estradiol. Has very low activity towards testosterone. The heteroteramer with CBR4 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity. May play a role in biosynthesis of fatty acids in mitochondria.
Product Categories/Family for anti-HSD17B8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29.1 kDa (281aa), confirmed by MALDI-TOF
NCBI Official Full Name
estradiol 17-beta-dehydrogenase 8
NCBI Official Synonym Full Names
hydroxysteroid 17-beta dehydrogenase 8
NCBI Official Symbol
HSD17B8
NCBI Official Synonym Symbols
KE6; FABG; HKE6; FABGL; RING2; H2-KE6; SDR30C1; D6S2245E; dJ1033B10.9
NCBI Protein Information
estradiol 17-beta-dehydrogenase 8
UniProt Protein Name
Estradiol 17-beta-dehydrogenase 8
UniProt Gene Name
HSD17B8
UniProt Synonym Gene Names
FABGL; HKE6; RING2; 17-beta-HSD 8; Ke-6
UniProt Entry Name
DHB8_HUMAN

NCBI Description

In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

HSD17B8: NAD-dependent 17-beta-hydroxysteroid dehydrogenase with highest activity towards estradiol. Has very low activity towards testosterone. The heteroteramer with CBR4 has NADH-dependent 3- ketoacyl-acyl carrier protein reductase activity. May play a role in biosynthesis of fatty acids in mitochondria. Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Protein type: Lipid Metabolism - androgen and estrogen; Oxidoreductase; Mitochondrial; EC 1.1.1.62; EC 1.1.1.239

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: mitochondrial envelope; mitochondrial matrix; plasma membrane

Molecular Function: estradiol 17-beta-dehydrogenase activity; protein binding; 3-hydroxyacyl-CoA dehydrogenase activity; 3-alpha(17-beta)-hydroxysteroid dehydrogenase (NAD+) activity

Biological Process: androgen metabolic process; estrogen biosynthetic process; fatty acid biosynthetic process

Research Articles on HSD17B8

Similar Products

Product Notes

The HSD17B8 hsd17b8 (Catalog #AAA6137059) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HSD17B8 (Estradiol 17-beta-dehydrogenase 8, 17-beta-hydroxysteroid Dehydrogenase 8, 17-beta-HSD 8, 3-oxoacyl-[acyl-carrier-protein] Reductase, Protein Ke6, Ke-6, Really Interesting New Gene 2 Protein, Testosterone 17-beta-dehydrogenase 8, FABGL, HKE6, RIN reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSD17B8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HSD17B8 hsd17b8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HSD17B8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.