Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HSD17B8 expression in transfected 293T cell line by HSD17B8 polyclonal antibody. Lane 1: HSD17B8 transfected lysate (27kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human HSD17B8 Polyclonal Antibody

HSD17B8 (Estradiol 17-beta-dehydrogenase 8, 17-beta-hydroxysteroid Dehydrogenase 8, 17-beta-HSD 8, 3-oxoacyl-[acyl-carrier-protein] Reductase, Protein Ke6, Ke-6, Really Interesting New Gene 2 Protein, Testosterone 17-beta-dehydrogenase 8, FABGL, HKE6, RIN

Reactivity
Human
Applications
Western Blot, Immunoprecipitation
Purity
Serum
Serum
Synonyms
HSD17B8; Polyclonal Antibody; HSD17B8 (Estradiol 17-beta-dehydrogenase 8; 17-beta-hydroxysteroid Dehydrogenase 8; 17-beta-HSD 8; 3-oxoacyl-[acyl-carrier-protein] Reductase; Protein Ke6; Ke-6; Really Interesting New Gene 2 Protein; Testosterone 17-beta-dehydrogenase 8; FABGL; HKE6; RIN; Anti -HSD17B8 (Estradiol 17-beta-dehydrogenase 8; anti-HSD17B8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HSD17B8.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM
Applicable Applications for anti-HSD17B8 antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes
Suitable for use in Immunoprecipitation and Western Blot.
Immunogen
Full length human HSD17B8, aa1-261 (NP_055049.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HSD17B8 expression in transfected 293T cell line by HSD17B8 polyclonal antibody. Lane 1: HSD17B8 transfected lysate (27kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HSD17B8 expression in transfected 293T cell line by HSD17B8 polyclonal antibody. Lane 1: HSD17B8 transfected lysate (27kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of HSD17B8 transfected lysate using HSD17B8 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with HSD17B8 purified mouse polyclonal antibody)

Immunoprecipitation (IP) (Immunoprecipitation of HSD17B8 transfected lysate using HSD17B8 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with HSD17B8 purified mouse polyclonal antibody)
Related Product Information for anti-HSD17B8 antibody
NAD-dependent 17-beta-hydroxysteroid dehydrogenase with highest activity towards estradiol. Has very low activity towards testosterone. The heteroteramer with CBR4 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity. May play a role in biosynthesis of fatty acids in mitochondria.
Product Categories/Family for anti-HSD17B8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
HSD17B8

Similar Products

Product Notes

The HSD17B8 (Catalog #AAA6012761) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSD17B8 (Estradiol 17-beta-dehydrogenase 8, 17-beta-hydroxysteroid Dehydrogenase 8, 17-beta-HSD 8, 3-oxoacyl-[acyl-carrier-protein] Reductase, Protein Ke6, Ke-6, Really Interesting New Gene 2 Protein, Testosterone 17-beta-dehydrogenase 8, FABGL, HKE6, RIN reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSD17B8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunoprecipitation (IP). Suitable for use in Immunoprecipitation and Western Blot. Researchers should empirically determine the suitability of the HSD17B8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASQLQNRLR SALALVTGAG SGIGRAVSVR LAGEGATVAA CDLDRAAAQE TVRLLGGPGS KEGPPRGNHA AFQADVSEAR AARCLLEQVQ ACFSRPPSVV VSCAGITQDE FLLHMSEDDW DKVIAVNLKG TFLVTQAAAQ ALVSNGCRGS IINISSIVGK VGNVGQTNYA ASKAGVIGLT QTAARELGRH GIRCNSVLPG FIATPMTQKV PQKVVDKITE MIPMGHLGDP EDVADVVAFL ASEDSGYITG TSVEVTGGLF M. It is sometimes possible for the material contained within the vial of "HSD17B8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.