Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.62kD).)

Mouse anti-Human DARS Monoclonal Antibody | anti-DARS antibody

DARS (Aspartyl-tRNA Synthetase, Cytoplasmic, Aspartate-tRNA Ligase, AspRS, Cell Proliferation-inducing Gene 40 Protein, PIG40) APC

Gene Names
DARS; HBSL; aspRS
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DARS; Monoclonal Antibody; DARS (Aspartyl-tRNA Synthetase; Cytoplasmic; Aspartate-tRNA Ligase; AspRS; Cell Proliferation-inducing Gene 40 Protein; PIG40) APC; anti-DARS antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F11
Specificity
Recognizes human DARS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-DARS antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa393-500 from human DARS (NP_001340) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLT
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.62kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.62kD).)

Western Blot (WB)

(Western Blot analysis of DARS expression in transfected 293T cell line by DARS monoclonal antibody. Lane 1: DARS transfected lysate (57.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DARS expression in transfected 293T cell line by DARS monoclonal antibody. Lane 1: DARS transfected lysate (57.1kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to DARS on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to DARS on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged DARS is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DARS is ~0.3ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of DARS over-expressed 293 cell line, cotransfected with DARS Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with DARS monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of DARS over-expressed 293 cell line, cotransfected with DARS Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with DARS monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(DARS monoclonal antibody Western Blot analysis of DARS expression in HeLa.)

Western Blot (WB) (DARS monoclonal antibody Western Blot analysis of DARS expression in HeLa.)
Product Categories/Family for anti-DARS antibody
References
1. Proteomic identification of putative biomarkers of radiotherapy resistance: a possible role for the 26S proteasome? Smith L, Qutob O, Watson MB, Beavis AW, Potts D, Welham KJ, Garimella V, Lind MJ, Drew PJ, Cawkwell L.Neoplasia. 2009 Nov;11(11):1194-207.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59.3 kDa (521aa)
NCBI Official Full Name
aspartate--tRNA ligase, cytoplasmic isoform 1
NCBI Official Synonym Full Names
aspartyl-tRNA synthetase
NCBI Official Symbol
DARS
NCBI Official Synonym Symbols
HBSL; aspRS
NCBI Protein Information
aspartate--tRNA ligase, cytoplasmic
UniProt Protein Name
Aspartate--tRNA ligase, cytoplasmic
UniProt Gene Name
DARS
UniProt Synonym Gene Names
AspRS
UniProt Entry Name
SYDC_HUMAN

NCBI Description

This gene encodes a member of a multienzyme complex that functions in mediating the attachment of amino acids to their cognate tRNAs. The encoded protein ligates L-aspartate to tRNA(Asp). Mutations in this gene have been found in patients showing hypomyelination with brainstem and spinal cord involvement and leg spasticity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014]

Uniprot Description

DARS: Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA. Belongs to the class-II aminoacyl-tRNA synthetase family.

Protein type: Translation; EC 6.1.1.12; Ligase

Chromosomal Location of Human Ortholog: 2q21.3

Cellular Component: membrane; cytoplasm; cytosol

Molecular Function: protein binding; aspartate-tRNA ligase activity; ATP binding; aminoacylase activity

Biological Process: tRNA aminoacylation for protein translation; translation; aspartyl-tRNA aminoacylation; protein complex assembly; gene expression

Disease: Hypomyelination With Brainstem And Spinal Cord Involvement And Leg Spasticity

Research Articles on DARS

Similar Products

Product Notes

The DARS dars (Catalog #AAA6136165) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DARS (Aspartyl-tRNA Synthetase, Cytoplasmic, Aspartate-tRNA Ligase, AspRS, Cell Proliferation-inducing Gene 40 Protein, PIG40) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DARS can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DARS dars for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DARS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.