Mouse anti-Human DARS Monoclonal Antibody | anti-DARS antibody

DARS (Aspartyl-tRNA Synthetase, Cytoplasmic, Aspartate-tRNA Ligase, AspRS, Cell Proliferation-inducing Gene 40 Protein, PIG40) (FITC)

Cat. Num. AAA6146771

• Gene Names: DARS; HBSL; aspRS
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DARS; Monoclonal Antibody; DARS (Aspartyl-tRNA Synthetase; Cytoplasmic; Aspartate-tRNA Ligase; AspRS; Cell Proliferation-inducing Gene 40 Protein; PIG40) (FITC); anti-DARS antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2F11
• Specificity: Recognizes human DARS.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-DARS antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa393-500 from human DARS (NP_001340) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLT
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.62kD).)

Western Blot (WB)

(Western Blot analysis of DARS expression in transfected 293T cell line by DARS monoclonal antibody. Lane 1: DARS transfected lysate (57.1kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to DARS on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged DARS is ~0.3ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of DARS over-expressed 293 cell line, cotransfected with DARS Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with DARS monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(DARS monoclonal antibody Western Blot analysis of DARS expression in HeLa.)

Product Categories/Family for anti-DARS antibody

Antibodies; Enzymes; Synthase

References

1. Proteomic identification of putative biomarkers of radiotherapy resistance: a possible role for the 26S proteasome? Smith L, Qutob O, Watson MB, Beavis AW, Potts D, Welham KJ, Garimella V, Lind MJ, Drew PJ, Cawkwell L.Neoplasia. 2009 Nov;11(11):1194-207.

NCBI and Uniprot Product Information

• NCBI GI #: 45439306
• NCBI GeneID: 1615
• NCBI Accession #: NP_001340
• NCBI GenBank Nucleotide #: NM_001349
• UniProt Accession #: P14868; Q2TNI3; Q32Q69; Q53HV4; Q53YC5; Q68CR9; Q9BW52; A8K3J2; D3DP77
• Molecular Weight: 59.3 kDa (521aa)
• NCBI Official Full Name: aspartate--tRNA ligase, cytoplasmic isoform 1
• NCBI Official Synonym Full Names: aspartyl-tRNA synthetase
• NCBI Official Symbol: DARS
• NCBI Official Synonym Symbols: HBSL; aspRS
• NCBI Protein Information: aspartate--tRNA ligase, cytoplasmic
• UniProt Protein Name: Aspartate--tRNA ligase, cytoplasmic
• UniProt Gene Name: DARS
• UniProt Synonym Gene Names: AspRS
• UniProt Entry Name: SYDC_HUMAN

NCBI Description

This gene encodes a member of a multienzyme complex that functions in mediating the attachment of amino acids to their cognate tRNAs. The encoded protein ligates L-aspartate to tRNA(Asp). Mutations in this gene have been found in patients showing hypomyelination with brainstem and spinal cord involvement and leg spasticity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014]

Uniprot Description

DARS: Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA. Belongs to the class-II aminoacyl-tRNA synthetase family.

Protein type: Translation; EC 6.1.1.12; Ligase

Chromosomal Location of Human Ortholog: 2q21.3

Cellular Component: membrane; cytoplasm; cytosol

Molecular Function: protein binding; aspartate-tRNA ligase activity; ATP binding; aminoacylase activity

Biological Process: tRNA aminoacylation for protein translation; translation; aspartyl-tRNA aminoacylation; protein complex assembly; gene expression

Disease: Hypomyelination With Brainstem And Spinal Cord Involvement And Leg Spasticity