Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-AKAP7 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysateAKAP7 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit AKAP7 Polyclonal Antibody | anti-AKAP7 antibody

AKAP7 antibody - middle region

Gene Names
AKAP7; AKAP15; AKAP18
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
AKAP7; Polyclonal Antibody; AKAP7 antibody - middle region; anti-AKAP7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKKKQSN
Sequence Length
326
Applicable Applications for anti-AKAP7 antibody
Western Blot (WB)
Homology
Cow: 83%; Dog: 91%; Horse: 92%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AKAP7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-AKAP7 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysateAKAP7 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-AKAP7 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysateAKAP7 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-AKAP7 antibody
This is a rabbit polyclonal antibody against AKAP7. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: AKAP7 is a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined.This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined.
Product Categories/Family for anti-AKAP7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
A-kinase anchoring protein 7 isoform gamma
NCBI Official Synonym Full Names
A-kinase anchoring protein 7
NCBI Official Symbol
AKAP7
NCBI Official Synonym Symbols
AKAP15; AKAP18
NCBI Protein Information
A-kinase anchoring protein 7
UniProt Protein Name
A-kinase anchor protein 7 isoform gamma
Protein Family
UniProt Gene Name
AKAP7
UniProt Synonym Gene Names
AKAP18; AKAP-7 isoform gamma; AKAP 18; PRKA7 isoform gamma
UniProt Entry Name
AKA7G_HUMAN

NCBI Description

This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Apr 2011]

Research Articles on AKAP7

Similar Products

Product Notes

The AKAP7 akap7 (Catalog #AAA3203082) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AKAP7 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AKAP7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AKAP7 akap7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKLSKSPWLR KNGVKKIDPD LYEKFISHRF GEEILYRIDL CSMLKKKQSN. It is sometimes possible for the material contained within the vial of "AKAP7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.