Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (71.06kD).)

Mouse anti-Human CTSD Monoclonal Antibody | anti-CTSD antibody

CTSD (Cathepsin D, CPSD) APC

Gene Names
CTSD; CPSD; CLN10; HEL-S-130P
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CTSD; Monoclonal Antibody; CTSD (Cathepsin D; CPSD) APC; anti-CTSD antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3F12-1B9
Specificity
Recognizes human CTSD.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CTSD antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 1.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa26-412 from human CTSD (AAH16320) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (71.06kD).)

Western Blot (WB) (Western Blot detection against Immunogen (71.06kD).)

Western Blot (WB)

(Western Blot analysis of CTSD expression in transfected 293T cell line by CTSD monoclonal antibody. Lane 1: CTSD transfected lysate (44.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CTSD expression in transfected 293T cell line by CTSD monoclonal antibody. Lane 1: CTSD transfected lysate (44.6kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CTSD on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CTSD on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5ug/ml].)

Immunoprecipitation (IP)

(Immunoprecipitation of CTSD transfected lysate using CTSD monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CTSD rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of CTSD transfected lysate using CTSD monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CTSD rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged CTSD is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CTSD is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-CTSD antibody
References
1. Characterization of the Human Gastric Fluid Proteome Reveals Distinct pH-Dependent Protein Profiles: Implications for Biomarker Studies. Kam SY, Hennessy T, Chua SC, Gan CS, Philp R, Hon KK, Lai L, Chan WH, Ong HS, Wong WK, Lim KH, Ling KL, Tan HS, Tan MM, Ho M, Kon OL.J Proteome Res. 2011 Aug 15.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
44,552 Da
NCBI Official Full Name
Homo sapiens cathepsin D, mRNA
NCBI Official Synonym Full Names
cathepsin D
NCBI Official Symbol
CTSD
NCBI Official Synonym Symbols
CPSD; CLN10; HEL-S-130P
NCBI Protein Information
cathepsin D
Protein Family

NCBI Description

This gene encodes a member of the A1 family of peptidases. The encoded preproprotein is proteolytically processed to generate multiple protein products. These products include the cathepsin D light and heavy chains, which heterodimerize to form the mature enzyme. This enzyme exhibits pepsin-like activity and plays a role in protein turnover and in the proteolytic activation of hormones and growth factors. Mutations in this gene play a causal role in neuronal ceroid lipofuscinosis-10 and may be involved in the pathogenesis of several other diseases, including breast cancer and possibly Alzheimer's disease. [provided by RefSeq, Nov 2015]

Research Articles on CTSD

Similar Products

Product Notes

The CTSD (Catalog #AAA6136106) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CTSD (Cathepsin D, CPSD) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CTSD can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 1.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CTSD for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CTSD, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.