Testing Data
(Detection limit is ~0.1ng/ml using MBS6003179 as a capture antibody.)
Mouse anti-Human CD316 Monoclonal Antibody | anti-CD316 antibody
CD316 (Immunoglobulin Superfamily member 8, CD81 partner 3, Glu-Trp-Ile EWI motif-containing protein 2, EWI-2, Keratinocytes-associated transmembrane protein 4, KCT-4, LIR-D1, IGSF8, CD81P3, EWI2, KCT4) APC
Gene Names
IGSF8; EWI2; PGRL; CD316; EWI-2; KCT-4; CD81P3; LIR-D1
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD316; Monoclonal Antibody; CD316 (Immunoglobulin Superfamily member 8; CD81 partner 3; Glu-Trp-Ile EWI motif-containing protein 2; EWI-2; Keratinocytes-associated transmembrane protein 4; KCT-4; LIR-D1; IGSF8; CD81P3; EWI2; KCT4) APC; anti-CD316 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E4
Specificity
Recognizes human CD316.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1750
Applicable Applications for anti-CD316 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa220-322 from human CD316 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PAGAPGPGRLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLREAASARSRPLPVHVREEGVVLEAVAWLAGGT
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit is ~0.1ng/ml using MBS6003179 as a capture antibody.)
Testing Data
(Detection limit is ~0.1ng/ml using MBS6003179 as a capture antibody.)
Related Product Information for anti-CD316 antibody
CD316 antigen forms highly proximal, specific, and stoichiometric complexes with CD81 and CD9. It may play a key role in the diverse functions of CD81 and CD9 such as oocytes fertilisation or hepaptitis C virus function. It may regulate proliferation and differentiation of keratinocytes and may negatively regulate cell motility. It may also participate in the regulation of neurite outgrowth and maintenance of the neural network in the adult brain. CD316 antigen is a transmembrane protein that is expressed in brain, kidney, testis, liver and placenta with moderate expression in all other tissues. It is detected on a majority of B-cells, T-cells and natural killer cells but not on monocytes, polynuclear cells and platelets.
Product Categories/Family for anti-CD316 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens immunoglobulin superfamily, member 8, mRNA
NCBI Official Synonym Full Names
immunoglobulin superfamily member 8
NCBI Official Symbol
IGSF8
NCBI Official Synonym Symbols
EWI2; PGRL; CD316; EWI-2; KCT-4; CD81P3; LIR-D1
NCBI Protein Information
immunoglobulin superfamily member 8
NCBI Description
This gene encodes a member the EWI subfamily of the immunoglobulin protein superfamily. Members of this family contain a single transmembrane domain, an EWI (Glu-Trp-Ile)-motif and a variable number of immunoglobulin domains. This protein interacts with the tetraspanins CD81 and CD9 and may regulate their role in certain cellular functions including cell migration and viral infection. The encoded protein may also function as a tumor suppressor by inhibiting the proliferation of certain cancers. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2011]
Research Articles on CD316
Similar Products
Product Notes
The CD316 (Catalog #AAA6135750) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD316 (Immunoglobulin Superfamily member 8, CD81 partner 3, Glu-Trp-Ile EWI motif-containing protein 2, EWI-2, Keratinocytes-associated transmembrane protein 4, KCT-4, LIR-D1, IGSF8, CD81P3, EWI2, KCT4) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD316 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD316 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD316, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
