Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ZNF174 monoclonal antibody Western Blot analysis of ZNF174 expression in SW-13)

Mouse anti-Human ZNF174 Monoclonal Antibody | anti-ZNF174 antibody

ZNF174 (Zinc Finger Protein 174, AW-1, Zinc Finger and SCAN Domain-containing Protein 8, ZSCAN8) (AP)

Gene Names
ZNF174; ZSCAN8
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ZNF174; Monoclonal Antibody; ZNF174 (Zinc Finger Protein 174; AW-1; Zinc Finger and SCAN Domain-containing Protein 8; ZSCAN8) (AP); anti-ZNF174 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2D7-E9
Specificity
Recognizes human ZNF174.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ZNF174 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-235 from human ZNF174 (AAH00876) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTELLIEKTDPNMATDELPCKLWLSFIA*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ZNF174 monoclonal antibody Western Blot analysis of ZNF174 expression in SW-13)

Western Blot (WB) (ZNF174 monoclonal antibody Western Blot analysis of ZNF174 expression in SW-13)

Western Blot (WB)

(Western Blot analysis of ZNF174 expression in transfected 293T cell line by ZNF174 monoclonal antibody Lane 1: ZNF174 transfected lysate (26kD). Lane 2: Non-transfected lysate)

Western Blot (WB) (Western Blot analysis of ZNF174 expression in transfected 293T cell line by ZNF174 monoclonal antibody Lane 1: ZNF174 transfected lysate (26kD). Lane 2: Non-transfected lysate)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ZNF174 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ZNF174 on HeLa cell. [antibody concentration 10ug/ml])

Western Blot (WB)

(Western blot analysis of ZNF174 over-expressed 293 cell line, cotransfected with ZNF174 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ZNF174 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of ZNF174 over-expressed 293 cell line, cotransfected with ZNF174 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ZNF174 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-ZNF174 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
26,884 Da
NCBI Official Full Name
Homo sapiens zinc finger protein 174, mRNA
NCBI Official Synonym Full Names
zinc finger protein 174
NCBI Official Symbol
ZNF174
NCBI Official Synonym Symbols
ZSCAN8
NCBI Protein Information
zinc finger protein 174
Protein Family

Research Articles on ZNF174

Similar Products

Product Notes

The ZNF174 (Catalog #AAA6134640) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF174 (Zinc Finger Protein 174, AW-1, Zinc Finger and SCAN Domain-containing Protein 8, ZSCAN8) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF174 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZNF174 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZNF174, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.