Mouse anti-Human ZNF174 Monoclonal Antibody | anti-ZNF174 antibody

ZNF174 (Zinc Finger Protein 174, AW-1, Zinc Finger and SCAN Domain-containing Protein 8, ZSCAN8) (Biotin)

Cat. Num. AAA6145246

• Gene Names: ZNF174; ZSCAN8
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ZNF174; Monoclonal Antibody; ZNF174 (Zinc Finger Protein 174; AW-1; Zinc Finger and SCAN Domain-containing Protein 8; ZSCAN8) (Biotin); anti-ZNF174 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2D7-E9
• Specificity: Recognizes human ZNF174.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-ZNF174 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-235 from human ZNF174 (AAH00876) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTELLIEKTDPNMATDELPCKLWLSFIA*
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ZNF174 monoclonal antibody Western Blot analysis of ZNF174 expression in SW-13)

Western Blot (WB)

(Western Blot analysis of ZNF174 expression in transfected 293T cell line by ZNF174 monoclonal antibody Lane 1: ZNF174 transfected lysate (26kD). Lane 2: Non-transfected lysate)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ZNF174 on HeLa cell. [antibody concentration 10ug/ml])

Western Blot (WB)

(Western blot analysis of ZNF174 over-expressed 293 cell line, cotransfected with ZNF174 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ZNF174 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-ZNF174 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 12654122
• NCBI GeneID: 7727
• Molecular Weight: 26,884 Da
• NCBI Official Full Name: Homo sapiens zinc finger protein 174, mRNA
• NCBI Official Synonym Full Names: zinc finger protein 174
• NCBI Official Symbol: ZNF174
• NCBI Official Synonym Symbols: ZSCAN8
• NCBI Protein Information: zinc finger protein 174
• Protein Family: Zinc finger protein