Western Blot (WB)
(WB Suggested Anti-ZNF322A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Rabbit ZNF322A Polyclonal Antibody | anti-ZNF322 antibody
ZNF322A antibody - N-terminal region
Gene Names
ZNF322; HCG12; ZNF388; ZNF489; ZNF322A
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF322A; Polyclonal Antibody; ZNF322A antibody - N-terminal region; anti-ZNF322 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RTHTGEKPYKCDMCEKTFVQSSDLTSHQRIHNYEKPYKCSKCEKSFWHHL
Sequence Length
402
Applicable Applications for anti-ZNF322 antibody
Western Blot (WB)
Homology
Cow: 91%; Dog: 93%; Goat: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 85%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF322A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ZNF322A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-ZNF322A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-ZNF322 antibody
This is a rabbit polyclonal antibody against ZNF322A. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ZNF322 contains four exons and spans 23.2kb in chromosome 6p22.1 region, and transcribes a 2.7kb mRNA that encodes a protein with 402 amino acid residues.Through northern blot analysis, ZNF322 was shown to be expressed in every human tissue examined at adult stage and during embryonic developmental stages from 80 days to 24 weeks. When ZNF322 was overexpressed in COS-7 cells, ZNF322-EGFP fusion protein is detected in the nucleus and cytoplasm. Reporter gene assays show that ZNF322 is a transcriptional activator. Furthermore, overexpression of ZNF322 in COS-7 cells activates the transcriptional activity of SRE and AP-1. Together, these results suggest that ZNF322 is a member of the zinc-finger transcription factor family and may act as a positive regulator in gene transcription mediated by the MAPK signaling pathways.
Target Description: ZNF322 contains four exons and spans 23.2kb in chromosome 6p22.1 region, and transcribes a 2.7kb mRNA that encodes a protein with 402 amino acid residues.Through northern blot analysis, ZNF322 was shown to be expressed in every human tissue examined at adult stage and during embryonic developmental stages from 80 days to 24 weeks. When ZNF322 was overexpressed in COS-7 cells, ZNF322-EGFP fusion protein is detected in the nucleus and cytoplasm. Reporter gene assays show that ZNF322 is a transcriptional activator. Furthermore, overexpression of ZNF322 in COS-7 cells activates the transcriptional activity of SRE and AP-1. Together, these results suggest that ZNF322 is a member of the zinc-finger transcription factor family and may act as a positive regulator in gene transcription mediated by the MAPK signaling pathways.
Product Categories/Family for anti-ZNF322 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
zinc finger protein 322
NCBI Official Synonym Full Names
zinc finger protein 322
NCBI Official Symbol
ZNF322
NCBI Official Synonym Symbols
HCG12; ZNF388; ZNF489; ZNF322A
NCBI Protein Information
zinc finger protein 322
UniProt Protein Name
Zinc finger protein 322
Protein Family
UniProt Gene Name
ZNF322
UniProt Synonym Gene Names
ZNF322A; ZNF388; ZNF489
UniProt Entry Name
ZN322_HUMAN
NCBI Description
ZNF322A is a member of the zinc-finger transcription factor family and may regulate transcriptional activation in MAPK (see MAPK1; MIM 176948) signaling pathways (Li et al., 2004 [PubMed 15555580]).[supplied by OMIM, Mar 2008]
Research Articles on ZNF322
1. Silencing ZNF322 recapitulated the cellular and molecular effects seen upon miR-4317 overexpression.
Similar Products
Product Notes
The ZNF322 znf322 (Catalog #AAA3202905) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF322A antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF322A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF322 znf322 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RTHTGEKPYK CDMCEKTFVQ SSDLTSHQRI HNYEKPYKCS KCEKSFWHHL. It is sometimes possible for the material contained within the vial of "ZNF322A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
