Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SLC25A16 monoclonal antibody Western Blot analysis of SLC25A16 expression in HeLa)

Mouse anti-Human SLC25A16 Monoclonal Antibody | anti-SLC25A16 antibody

SLC25A16 (Graves Disease Carrier Protein, GDC, Graves Disease Autoantigen, GDA, Mitochondrial Solute Carrier Protein Homolog, Solute Carrier Family 25 Member 16, GDA) (AP)

Gene Names
SLC25A16; GDA; GDC; ML7; hML7; HGT.1; D10S105E
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC25A16; Monoclonal Antibody; SLC25A16 (Graves Disease Carrier Protein; GDC; Graves Disease Autoantigen; GDA; Mitochondrial Solute Carrier Protein Homolog; Solute Carrier Family 25 Member 16; GDA) (AP); anti-SLC25A16 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H7
Specificity
Recognizes human SLC25A16.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SLC25A16 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa59-134 from SLC25A16 (NP_689920) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHR*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SLC25A16 monoclonal antibody Western Blot analysis of SLC25A16 expression in HeLa)

Western Blot (WB) (SLC25A16 monoclonal antibody Western Blot analysis of SLC25A16 expression in HeLa)

Testing Data

(Detection limit for recombinant GST tagged SLC25A16 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC25A16 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-SLC25A16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,224 Da
NCBI Official Full Name
graves disease carrier protein
NCBI Official Synonym Full Names
solute carrier family 25 (mitochondrial carrier), member 16
NCBI Official Symbol
SLC25A16
NCBI Official Synonym Symbols
GDA; GDC; ML7; hML7; HGT.1; D10S105E
NCBI Protein Information
graves disease carrier protein; graves disease autoantigen; solute carrier family 25 member 16; mitochondrial solute carrier protein homolog; solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16
UniProt Protein Name
Graves disease carrier protein
UniProt Gene Name
SLC25A16
UniProt Synonym Gene Names
GDA; GDC; GDA
UniProt Entry Name
GDC_HUMAN

Similar Products

Product Notes

The SLC25A16 slc25a16 (Catalog #AAA6133798) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC25A16 (Graves Disease Carrier Protein, GDC, Graves Disease Autoantigen, GDA, Mitochondrial Solute Carrier Protein Homolog, Solute Carrier Family 25 Member 16, GDA) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A16 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC25A16 slc25a16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC25A16, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.