Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human DSE Monoclonal Antibody | anti-DSE antibody

DSE (Dermatan-sulfate Epimerase, DS Epimerase, Chondroitin-glucuronate 5-epimerase, Squamous Cell Carcinoma Antigen Recognized by T-cells 2, SART2, SART-2) (AP)

Gene Names
DSE; DSEP; DSEPI; SART2; EDSMC2; SART-2; DS-epi1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DSE; Monoclonal Antibody; DSE (Dermatan-sulfate Epimerase; DS Epimerase; Chondroitin-glucuronate 5-epimerase; Squamous Cell Carcinoma Antigen Recognized by T-cells 2; SART2; SART-2) (AP); EC=5.1.3.19; dJ323M4; dJ323M4.1; RP3-323M4.1; SH3D6A; anti-DSE antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6D4
Specificity
Recognizes human SART2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
958
Applicable Applications for anti-DSE antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa574-674 from human SART2 (NP_037484) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GEESPLETAASFFHNVDVPFEETVVDGVHGAFIRQRDGLYKMYWMDDTGYSEKATFASVTYPRGYPYNGTNYVNVTMHLRSPITRAAYLFIGPSIDVQS*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged SART2 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SART2 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-DSE antibody
DSE is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. This protein is localized to the endoplasmic reticulum.
Product Categories/Family for anti-DSE antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
dermatan-sulfate epimerase isoform a
NCBI Official Synonym Full Names
dermatan sulfate epimerase
NCBI Official Symbol
DSE
NCBI Official Synonym Symbols
DSEP; DSEPI; SART2; EDSMC2; SART-2; DS-epi1
NCBI Protein Information
dermatan-sulfate epimerase
UniProt Protein Name
Dermatan-sulfate epimerase
UniProt Gene Name
DSE
UniProt Synonym Gene Names
SART2; DS epimerase; SART-2
UniProt Entry Name
DSE_HUMAN

NCBI Description

The protein encoded by this gene is a tumor-rejection antigen. It is localized to the endoplasmic reticulum and functions to convert D-glucuronic acid to L-iduronic acid during the biosynthesis of dermatan sulfate. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. Mutations in this gene cause inmusculocontractural Ehlers-Danlos syndrome. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 9, and a paralogous gene exists on chromosome 18. [provided by RefSeq, Apr 2016]

Uniprot Description

SART2: Converts D-glucuronic acid to L-iduronic acid (IdoUA) residues. Belongs to the dermatan-sulfate isomerase family.

Protein type: Isomerase; Endoplasmic reticulum; Membrane protein, integral; EC 5.1.3.19; Glycan Metabolism - chondroitin sulfate biosynthesis; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 6q22

Cellular Component: Golgi membrane; Golgi apparatus; endoplasmic reticulum; integral to membrane

Molecular Function: chondroitin-glucuronate 5-epimerase activity

Biological Process: chondroitin sulfate metabolic process; chondroitin sulfate biosynthetic process; glycosaminoglycan metabolic process; heparan sulfate proteoglycan biosynthetic process; carbohydrate metabolic process; pathogenesis; dermatan sulfate biosynthetic process

Disease: Ehlers-danlos Syndrome, Musculocontractural Type 2

Research Articles on DSE

Similar Products

Product Notes

The DSE dse (Catalog #AAA6133608) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DSE (Dermatan-sulfate Epimerase, DS Epimerase, Chondroitin-glucuronate 5-epimerase, Squamous Cell Carcinoma Antigen Recognized by T-cells 2, SART2, SART-2) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DSE can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DSE dse for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DSE, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.