Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human PON1 Monoclonal Antibody | anti-PON1 antibody

PON1 (PON, Serum Paraoxonase/Arylesterase 1, Aromatic Esterase 1, K-45, Serum Aryldialkylphosphatase 1) (AP)

Gene Names
PON1; ESA; PON; MVCD5
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PON1; Monoclonal Antibody; PON1 (PON; Serum Paraoxonase/Arylesterase 1; Aromatic Esterase 1; K-45; Serum Aryldialkylphosphatase 1) (AP); anti-PON1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2H7
Specificity
Recognizes human PON1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PON1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa246-356 from human PON1 (NP_000437) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HVYEKHANWTLTPLKSLDFNTLVDNISVDPETGDLWVGCHPNGMKIFFYDSENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKALYCEL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged PON1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PON1 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-PON1 antibody
The enzyme encoded by this gene is an arylesterase that mainly hydrolyzes paroxon to produce p-nitrophenol. Paroxon is an organophosphorus anticholinesterase compound that is produced in vivo by oxidation of the insecticide parathion. Polymorphisms in this gene are a risk factor in coronary artery disease. The gene is found in a cluster of three related paraoxonase genes at 7q21.3.
Product Categories/Family for anti-PON1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,731 Da
NCBI Official Full Name
serum paraoxonase/arylesterase 1
NCBI Official Synonym Full Names
paraoxonase 1
NCBI Official Symbol
PON1
NCBI Official Synonym Symbols
ESA; PON; MVCD5
NCBI Protein Information
serum paraoxonase/arylesterase 1; A-esterase 1; K-45; PON 1; aromatic esterase 1; arylesterase B-type; esterase A; paraoxonase B-type; serum aryldiakylphosphatase; serum aryldialkylphosphatase 1
UniProt Protein Name
Serum paraoxonase/arylesterase 1
UniProt Gene Name
PON1
UniProt Synonym Gene Names
PON; PON 1
UniProt Entry Name
PON1_HUMAN

Uniprot Description

PON1: Hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. Capable of hydrolyzing a broad spectrum of organophosphate substrates and lactones, and a number of aromatic carboxylic acid esters. Mediates an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation. Genetic variation in PON1 is associated with susceptibility to microvascular complications of diabetes type 5 (MVCD5). These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new- onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. Homozygosity for the Leu-54 allele is strongly associated with the development of retinal disease in diabetic patients. Belongs to the paraoxonase family.

Protein type: EC 3.1.8.1; EC 3.1.1.2; Lipid-binding; Secreted, signal peptide; Motility/polarity/chemotaxis; EC 3.1.1.81; Hydrolase; Phosphatase (non-protein); Secreted

Chromosomal Location of Human Ortholog: 7q21.3

Cellular Component: extracellular space; intracellular membrane-bound organelle; extracellular region

Molecular Function: protein homodimerization activity; arylesterase activity; phospholipid binding; calcium ion binding; aryldialkylphosphatase activity

Biological Process: response to external stimulus; response to nutrient levels; dephosphorylation; response to toxin; organophosphate catabolic process; positive regulation of transporter activity; carboxylic acid catabolic process; positive regulation of binding; aromatic compound catabolic process; phosphatidylcholine metabolic process

Disease: Microvascular Complications Of Diabetes, Susceptibility To, 5

Similar Products

Product Notes

The PON1 pon1 (Catalog #AAA6133062) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PON1 (PON, Serum Paraoxonase/Arylesterase 1, Aromatic Esterase 1, K-45, Serum Aryldialkylphosphatase 1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PON1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PON1 pon1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PON1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.