Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human PARC Monoclonal Antibody | anti-PARC antibody

PARC (Cullin-9, CUL-9, p53-associated Parkin-like Cytoplasmic Protein, UbcH7-Associated Protein 1, CUL9, H7AP1, KIAA0708, DKFZp686G1042, DKFZp686P2024, RP3-330M21.2) (AP)

Gene Names
CUL9; PARC; H7AP1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PARC; Monoclonal Antibody; PARC (Cullin-9; CUL-9; p53-associated Parkin-like Cytoplasmic Protein; UbcH7-Associated Protein 1; CUL9; H7AP1; KIAA0708; DKFZp686G1042; DKFZp686P2024; RP3-330M21.2) (AP); anti-PARC antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F7
Specificity
Recognizes human PARC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PARC antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa918-1026 from PARC (NP_055904) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MMLLNRYSEPPGSPERAALETPIIQGQDGSPELLIRSLVGGPSAELLLDLERVLCREGSPGGAVRPLLKRLQQETQPFLLLLRTLDAPGPNKTLLLSVLRVITRLLDF*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Testing Data

(PARC monoclonal antibody Blot analysis of PARC expression in A-431.)

Testing Data (PARC monoclonal antibody Blot analysis of PARC expression in A-431.)
Related Product Information for anti-PARC antibody
Cytoplasmic anchor protein in p53-associated protein complex. Regulates the subcellular localization of p53 and subsequent function. Seems to be part of an atypical cullin-RING-based E3 ubiquitin-protein ligase complex. In vitro, complexes of CUL9/PARC with either CUL7 or TP53 contain E3 ubiquitin-protein ligase activity.
Product Categories/Family for anti-PARC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
268,362 Da
NCBI Official Full Name
cullin-9
NCBI Official Synonym Full Names
cullin 9
NCBI Official Symbol
CUL9
NCBI Official Synonym Symbols
PARC; H7AP1
NCBI Protein Information
cullin-9; CUL-9; UbcH7-associated protein 1; parkin-like cytoplasmic p53 binding protein; p53-associated parkin-like cytoplasmic protein
UniProt Protein Name
Cullin-9
Protein Family
UniProt Gene Name
CUL9
UniProt Synonym Gene Names
H7AP1; KIAA0708; PARC; CUL-9
UniProt Entry Name
CUL9_HUMAN

Uniprot Description

PARC: Cytoplasmic anchor protein in p53-associated protein complex. Regulates the subcellular localization of p53 and subsequent function. Seems to be part of an atypical cullin-RING- based E3 ubiquitin-protein ligase complex. In vitro, complexes of CUL9/PARC with either CUL7 or TP53 contain E3 ubiquitin-protein ligase activity. Belongs to the cullin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ligase; Ubiquitin ligase; Ubiquitin conjugating system; EC 6.3.2.-

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: cullin-RING ubiquitin ligase complex; cytoplasm

Molecular Function: protein binding; zinc ion binding; ubiquitin protein ligase binding; ATP binding

Biological Process: ubiquitin-dependent protein catabolic process; regulation of mitosis; protein ubiquitination; microtubule cytoskeleton organization and biogenesis

Research Articles on PARC

Similar Products

Product Notes

The PARC cul9 (Catalog #AAA6132763) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PARC (Cullin-9, CUL-9, p53-associated Parkin-like Cytoplasmic Protein, UbcH7-Associated Protein 1, CUL9, H7AP1, KIAA0708, DKFZp686G1042, DKFZp686P2024, RP3-330M21.2) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PARC can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PARC cul9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PARC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.