Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to LMO7 on HeLa cell. [antibody concentration 10ug/ml])

Mouse anti-Human LMO7 Monoclonal Antibody | anti-LMO7 antibody

LMO7 (LIM Domain Only Protein 7, LMO-7, F-box Only Protein 20, LOMP, FBX20, FBXO20, KIAA0858) (AP)

Gene Names
LMO7; LOMP; FBX20; LMO7b; FBXO20
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LMO7; Monoclonal Antibody; LMO7 (LIM Domain Only Protein 7; LMO-7; F-box Only Protein 20; LOMP; FBX20; FBXO20; KIAA0858) (AP); anti-LMO7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B4
Specificity
Recognizes human LMO7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
1349
Applicable Applications for anti-LMO7 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa453-540 from human LMO7 (NP_005349) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATYPSEIPKEDSTTFAKREDRVTTEIQLPSQSPVEEQSP
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to LMO7 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to LMO7 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-LMO7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
LIM domain only protein 7 isoform 1
NCBI Official Synonym Full Names
LIM domain 7
NCBI Official Symbol
LMO7
NCBI Official Synonym Symbols
LOMP; FBX20; LMO7b; FBXO20
NCBI Protein Information
LIM domain only protein 7
UniProt Protein Name
LIM domain only protein 7
Protein Family
UniProt Gene Name
LMO7
UniProt Synonym Gene Names
FBX20; FBXO20; KIAA0858; LMO-7
UniProt Entry Name
LMO7_HUMAN

NCBI Description

This gene encodes a protein containing a calponin homology (CH) domain, a PDZ domain, and a LIM domain, and may be involved in protein-protein interactions. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene, however, the full-length nature of some variants is not known. [provided by RefSeq, Jan 2009]

Uniprot Description

LMO7: contains a calponin homology (CH) domain, a PDZ domain, and a LIM domain; an F-box (FBX) domain is present in alternative splice variants. This protein is known to be upregulated in seven types of cancer. Translocates from the cell surface to the cytoplasm to the nucleus, regulates transcription of many genes, and may transmit mechanical signals from focal adhesions. Members of the LIM protein family carry the LIM domain, a unique cysteine-rich zinc-binding domain. Members of the FBX protein family are involved in protein-protein interactions. Four alternatively spliced isoforms have been described.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 13q22.2

Cellular Component: focal adhesion; cytoplasm; nucleus; ubiquitin ligase complex

Molecular Function: zinc ion binding; ubiquitin-protein ligase activity

Biological Process: regulation of cell adhesion; protein ubiquitination

Research Articles on LMO7

Similar Products

Product Notes

The LMO7 lmo7 (Catalog #AAA6132121) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LMO7 (LIM Domain Only Protein 7, LMO-7, F-box Only Protein 20, LOMP, FBX20, FBXO20, KIAA0858) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LMO7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LMO7 lmo7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LMO7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.