Mouse anti-Human Kinesin 2C Monoclonal Antibody | anti-KIF2C antibody

Kinesin 2C (KIF2C, Kinesein Family Member 2C, Kinesin-Like Protein 6, KNSL6, Kinesin-like Protein KIF2C, Mitotic Centromere-Associated Kinesin, MCAK, 4930402F02Rik, ESTM5, MGC11883, OTTHUMP00000010066, X83316) (AP)

Cat. Num. AAA6131996

• Gene Names: KIF2C; MCAK; CT139; KNSL6
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Kinesin 2C; Monoclonal Antibody; Kinesin 2C (KIF2C; Kinesein Family Member 2C; Kinesin-Like Protein 6; KNSL6; Kinesin-like Protein KIF2C; Mitotic Centromere-Associated Kinesin; MCAK; 4930402F02Rik; ESTM5; MGC11883; OTTHUMP00000010066; X83316) (AP); anti-KIF2C antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1G2
• Specificity: Recognizes human KIF2C.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-KIF2C antibody: ELISA (EIA), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from human KIF2C (AAH14924) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQKQKRRSVNSKI
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to KIF2C on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to KIF2C on HeLa cell. [antibody concentration 10ug/ml].)

Immunoprecipitation (IP)

(Immunoprecipitation of KIF2C transfected lysate using KIF2C monoclonal antibody and Protein A Magnetic Bead and immunoblotted with KIF2C rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged KIF2C is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of KIF2C over-expressed 293 cell line, cotransfected with KIF2C Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with KIF2C monoclonal antibody (M01). GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(Western Blot analysis of KIF2C expression in transfected 293T cell line by KIF2C monoclonal antibody Lane 1: KIF2C transfected lysate (81.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(KIF2C monoclonal antibody Western Blot analysis of KIF2C expression in HeLa NE.)

Product Categories/Family for anti-KIF2C antibody

Antibodies; Motor Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 15928917
• NCBI GeneID: 11004
• Molecular Weight: 75,561 Da
• NCBI Official Full Name: Homo sapiens kinesin family member 2C, mRNA
• NCBI Official Synonym Full Names: kinesin family member 2C
• NCBI Official Symbol: KIF2C
• NCBI Official Synonym Symbols: MCAK; CT139; KNSL6
• NCBI Protein Information: kinesin-like protein KIF2C
• Protein Family: Kinesin-like protein

NCBI Description

This gene encodes a kinesin-like protein that functions as a microtubule-dependent molecular motor. The encoded protein can depolymerize microtubules at the plus end, thereby promoting mitotic chromosome segregation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]