Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Mouse anti-Human GRM7 Monoclonal Antibody | anti-GRM7 antibody

GRM7 (Metabotropic Glutamate Receptor 7, mGluR7, GPRC1G, MGLUR7, FLJ40498) (AP)

Gene Names
GRM7; GLUR7; MGLU7; GPRC1G; MGLUR7; PPP1R87
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GRM7; Monoclonal Antibody; GRM7 (Metabotropic Glutamate Receptor 7; mGluR7; GPRC1G; MGLUR7; FLJ40498) (AP); anti-GRM7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H5
Specificity
Recognizes human GRM7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-GRM7 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa431-520 from human GRM7 (NP_000835) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ADYRGVCPEMEQAGGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIFQYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Testing Data

(Detection limit for recombinant GST tagged GRM7 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GRM7 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-GRM7 antibody
Receptor for glutamate. The activity of this receptor is mediated by a G-protein that inhibits adenylate cyclase activity.
Product Categories/Family for anti-GRM7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
99kDa
NCBI Official Full Name
metabotropic glutamate receptor 7 isoform a
NCBI Official Synonym Full Names
glutamate metabotropic receptor 7
NCBI Official Symbol
GRM7
NCBI Official Synonym Symbols
GLUR7; MGLU7; GPRC1G; MGLUR7; PPP1R87
NCBI Protein Information
metabotropic glutamate receptor 7
UniProt Protein Name
Metabotropic glutamate receptor 7
UniProt Gene Name
GRM7
UniProt Synonym Gene Names
GPRC1G; MGLUR7; mGluR7
UniProt Entry Name
GRM7_HUMAN

NCBI Description

L-glutamate is the major excitatory neurotransmitter in the central nervous system, and it activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors that have been divided into three groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5, and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3, while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2009]

Uniprot Description

mGluR7: Receptor for glutamate. The activity of this receptor is mediated by a G-protein that inhibits adenylate cyclase activity. Belongs to the G-protein coupled receptor 3 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 3; Receptor, GPCR

Chromosomal Location of Human Ortholog: 3p26.1-p25.1

Cellular Component: presynaptic membrane; asymmetric synapse; postsynaptic membrane; axon; integral to plasma membrane; dendrite; presynaptic active zone; integral to membrane; plasma membrane; dendritic shaft; cell cortex; receptor complex

Molecular Function: voltage-gated calcium channel activity; group III metabotropic glutamate receptor activity; glutamate binding; calcium channel regulator activity; calcium ion binding; glutamate receptor activity; PDZ domain binding

Biological Process: behavioral fear response; regulation of synaptic transmission, glutamatergic; negative regulation of glutamate secretion; short-term memory; sensory perception of smell; negative regulation of adenylate cyclase activity; regulation of cyclase activity; transmission of nerve impulse; synaptic transmission; negative regulation of cAMP biosynthetic process; sensory perception of sound; adult behavior; conditioned taste aversion; metabotropic glutamate receptor, adenylate cyclase inhibiting pathway

Research Articles on GRM7

Similar Products

Product Notes

The GRM7 grm7 (Catalog #AAA6131568) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GRM7 (Metabotropic Glutamate Receptor 7, mGluR7, GPRC1G, MGLUR7, FLJ40498) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GRM7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GRM7 grm7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GRM7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.