Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to GMPS on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5ug/ml].)

Mouse anti-Human GMPS Monoclonal Antibody | anti-GMPS antibody

GMPS (GMP Synthase [Glutamine-hydrolyzing], Glutamine Amidotransferase, GMP Synthetase) (AP)

Gene Names
GMPS; GATD7
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GMPS; Monoclonal Antibody; GMPS (GMP Synthase [Glutamine-hydrolyzing]; Glutamine Amidotransferase; GMP Synthetase) (AP); anti-GMPS antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D10
Specificity
Recognizes human GMPS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-GMPS antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa108-215 from GMPS (NP_003866) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSG
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to GMPS on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5ug/ml].)

Testing Data (Immunoperoxidase of monoclonal antibody to GMPS on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged GMPS is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GMPS is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-GMPS antibody
References
1. Proteomic analysis of the effects of the immunomodulatory mycotoxin deoxynivalenol. da Costa AN, Mijal RS, Keen JN, Findlay JB, Wild CP.Proteomics. 2011 Mar 9. doi: 10.1002/pmic.201000580.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79.2 kDa (717aa)
NCBI Official Full Name
GMP synthase
NCBI Official Synonym Full Names
guanine monophosphate synthase
NCBI Official Symbol
GMPS
NCBI Official Synonym Symbols
GATD7
NCBI Protein Information
GMP synthase [glutamine-hydrolyzing]
UniProt Protein Name
GMP synthase [glutamine-hydrolyzing]
UniProt Gene Name
GMPS
UniProt Entry Name
GUAA_HUMAN

NCBI Description

In the de novo synthesis of purine nucleotides, IMP is the branch point metabolite at which point the pathway diverges to the synthesis of either guanine or adenine nucleotides. In the guanine nucleotide pathway, there are 2 enzymes involved in converting IMP to GMP, namely IMP dehydrogenase (IMPD1), which catalyzes the oxidation of IMP to XMP, and GMP synthetase, which catalyzes the amination of XMP to GMP. [provided by RefSeq, Jul 2008]

Uniprot Description

GMPS: Involved in the de novo synthesis of guanine nucleotides which are not only essential for DNA and RNA synthesis, but also provide GTP, which is involved in a number of cellular processes important for cell division. A chromosomal aberration involving GMPS is found in acute myeloid leukemias. Translocation t(3,11)(q25,q23) with MLL.

Protein type: Xenobiotic Metabolism - drug metabolism - other enzymes; Oncoprotein; Ligase; Nucleotide Metabolism - purine; EC 6.3.5.2

Chromosomal Location of Human Ortholog: 3q24

Cellular Component: cytoplasm; cytosol

Molecular Function: pyrophosphatase activity; enzyme binding; GMP synthase activity; GMP synthase (glutamine-hydrolyzing) activity; ATP binding

Biological Process: response to drug; purine ribonucleoside monophosphate biosynthetic process; purine base biosynthetic process; nucleobase, nucleoside and nucleotide metabolic process; GMP biosynthetic process; glutamine metabolic process; purine base metabolic process

Disease: Leukemia, Acute Myeloid

Research Articles on GMPS

Similar Products

Product Notes

The GMPS gmps (Catalog #AAA6131503) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GMPS (GMP Synthase [Glutamine-hydrolyzing], Glutamine Amidotransferase, GMP Synthetase) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GMPS can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GMPS gmps for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GMPS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.