Mouse GMPS Monoclonal Antibody | anti-GMPS antibody

GMPS (Guanine monphosphate Synthetase) (HRP)

Cat. Num. AAA6182628

• Gene Names: GMPS; GATD7
• Applications: Western Blot
• Purity: Purified
• Synonyms: GMPS; Monoclonal Antibody; GMPS (Guanine monphosphate Synthetase) (HRP); Guanine monphosphate Synthetase; anti-GMPS antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 6B5
• Specificity: Recognizes GMPS.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-GMPS antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: GMPS (NP_003866, 108aa-215aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSG
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged GMPS is 0.03 ng/ml as a capture antibody.)

Product Categories/Family for anti-GMPS antibody

Antibodies; Enzymes; Synthetase

NCBI and Uniprot Product Information

• NCBI GI #: 4504035
• NCBI GeneID: 8833
• NCBI Accession #: NP_003866
• NCBI GenBank Nucleotide #: NM_003875.2
• UniProt Accession #: P49915; A8K639; B4DXV7; F8W720
• Molecular Weight: 79.2 kDa (717aa)
• NCBI Official Full Name: GMP synthase
• NCBI Official Synonym Full Names: guanine monophosphate synthase
• NCBI Official Symbol: GMPS
• NCBI Official Synonym Symbols: GATD7
• NCBI Protein Information: GMP synthase [glutamine-hydrolyzing]
• UniProt Protein Name: GMP synthase [glutamine-hydrolyzing]
• UniProt Gene Name: GMPS
• UniProt Entry Name: GUAA_HUMAN

NCBI Description

In the de novo synthesis of purine nucleotides, IMP is the branch point metabolite at which point the pathway diverges to the synthesis of either guanine or adenine nucleotides. In the guanine nucleotide pathway, there are 2 enzymes involved in converting IMP to GMP, namely IMP dehydrogenase (IMPD1), which catalyzes the oxidation of IMP to XMP, and GMP synthetase, which catalyzes the amination of XMP to GMP. [provided by RefSeq, Jul 2008]

Uniprot Description

GMPS: Involved in the de novo synthesis of guanine nucleotides which are not only essential for DNA and RNA synthesis, but also provide GTP, which is involved in a number of cellular processes important for cell division. A chromosomal aberration involving GMPS is found in acute myeloid leukemias. Translocation t(3,11)(q25,q23) with MLL.

Protein type: Xenobiotic Metabolism - drug metabolism - other enzymes; Oncoprotein; Ligase; Nucleotide Metabolism - purine; EC 6.3.5.2

Chromosomal Location of Human Ortholog: 3q24

Cellular Component: cytoplasm; cytosol

Molecular Function: pyrophosphatase activity; enzyme binding; GMP synthase activity; GMP synthase (glutamine-hydrolyzing) activity; ATP binding

Biological Process: response to drug; purine ribonucleoside monophosphate biosynthetic process; purine base biosynthetic process; nucleobase, nucleoside and nucleotide metabolic process; GMP biosynthetic process; glutamine metabolic process; purine base metabolic process

Disease: Leukemia, Acute Myeloid