Mouse anti-Human CBS Monoclonal Antibody | anti-CBS antibody

CBS (Cystathionine beta-synthase, Serine Sulfhydrase, Beta-thionase) (AP)

Cat. Num. AAA6130384

• Gene Names: CBS; HIP4
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CBS; Monoclonal Antibody; CBS (Cystathionine beta-synthase; Serine Sulfhydrase; Beta-thionase) (AP); anti-CBS antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3E1
• Specificity: Recognizes human CBS.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-CBS antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from human CBS (NP_000062) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CBS expression in transfected 293T cell line by 124401. Lane 1: CBS transfected lysate (61kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of formalin-fixed paraffin-embedded human hepatocellular carcinoma using 124401 (3ug/ml).)

Immunoprecipitation (IP)

(Immunoprecipitation of CBS transfected lysate using 124401and Protein A Magnetic Bead and immunoblotted with CBS rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged CBS is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of CBS over-expressed 293 cell line, cotransfected with CBS Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with 124401. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(CBS monoclonal antibody, Western Blot analysis of CBS expression in HeLa.)

Western Blot (WB)

(CBS monoclonal antibody. Western Blot analysis of CBS expression in MCF-7.)

Product Categories/Family for anti-CBS antibody

Antibodies; Enzymes; Synthase

References

1. Hydrogen sulfide and resolution of acute inflammation: A comparative study utilizing a novel fluorescent probe. Dufton N, Natividad J, Verdu EF, Wallace JL.Sci Rep. 2012;2:499. Epub 2012 Jul 9. 2. Characterization of Hydrogen Sulfide and Its Synthases, Cystathionine ?]-Synthase and Cystathionine ?^-Lyase, in Human Prostatic Tissue and Cells. Guo H, Gai JW, Wang Y, Jin HF, Du JB, Jin J.Urology. 2012 Feb;79(2):483.e1-5. 3. Homocystinuria in Taiwan: An inordinately high prevalence in an Austronesian aboriginal tribe, Tao. Lu YH, Huang YH, Cheng LM, Yu HC, Hsu JH, Wu JT, Lo MY, Lin A, Lin CY, Wu JY, Niu DM.Molecular Genetics and Metabolism (2012), doi: 10.1016/j. ymgme.2012.01.021 4. Hydrogen Sulfide in the RVLM and PVN has No Effect on Cardiovascular Regulation. Streeter E, Al-Magableh M, Hart JL, Badoer E.Front Physiol. 2011;2:55. Epub 2011 Sep 1. 5. Interdependency of Cystathione ?^-Lyase and Cystathione ?]-Synthase in Hydrogen Sulfide-Induced Blood Pressure Regulation in Rats. Roy A, Khan AH, Islam MT, Prieto MC, Majid DS.Am J Hypertens. 2011 Aug 25. doi: 10.1038/ajh.2011.149. 6. Placental markers of folate-related metabolism in preeclampsia. Mislanova C, Martsenyuk O, Huppertz B, Obolenskaya MY.Reproduction. 2011 Jun 20. 7. Multiple hemodynamic effects of endogenous hydrogen sulfide on central nervous system in rats. Ren YS, Wu SY, Wang XJ, Yu F, Zhao J, Tang CS, Ouyang JP, Geng B.Chin Med J 2011;124(21):3468-3475. 8. Hydrogen Sulfide Modulates Contractile Function in Rat Jejunum. Kasparek MS, Linden DR, Farrugia G, Sarr MG.J Surg Res. 2011 Apr 22. 9. Carbon monoxide stimulates global protein methylation via its inhibitory action on cystathionine beta-synthase. Yamamoto T, Takano N, Ishiwata K, Suematsu M.J. Clin. Biochem. Nutr., 48, 96-100, 2010. 10. The hydrogen sulfide signaling system: changes during aging and the benefits of caloric restriction. Predmore BL, Alendy MJ, Ahmed KI, Leeuwenburgh C, Julian D.Age (Dordr). 2010 Dec;32(4):467-81. Epub 2010 May 26. 11. A Crucial Role for Hydrogen Sulfide in Oxygen Sensing via Modulating Large Conductance Calcium-Activated Potassium Channels. Li Q, Sun B, Wang X, Jin Z, Zhou Y, Dong L, Jiang LH, Rong W.Antioxid Redox Signal. 2010 May 15;12(10):1179-89. 12. Rescue of cystathionine beta-synthase (CBS) mutants with chemical chaperones: purification and characterization of eight CBS mutant enzymes. Majtan T, Liu L, Carpenter JF, Kraus JP.J Biol Chem. 2010 Mar 22. 13. Actions of hydrogen sulphide on ion transport across rat distal colon. Hennig B, Diener M.Br J Pharmacol. 2009 Nov;158(5):1263-75. Epub 2009 Sep 25. 14. The endogenous hydrogen sulfide producing enzyme cystathionine-?] synthase contributes to visceral hypersensitivity in a rat model of irritable bowel syndrome. Xu GY, Winston JH, Shenoy M, Zhou S, Chen JD, Pasricha PJ.Mol Pain. 2009 Aug 6;5:44. 15. Astrocytes produce the antiinflammatory and neuroprotective agent hydrogen sulfide. Lee M, Schwab C, Yu S, McGeer E, McGeer PL.Neurobiol Aging. 2009 Oct;30(10):1523-34. Epub 2009 Jul 23. 16. Hydrogen sulphide synthesis in the rat and mouse gastrointestinal tract. Martin GR, McKnight GW, Dicay MS, Coffin CS, Ferraz JG, Wallace JL.Dig Liver Dis. 2009 Jun 29. 17. Endogenous and Exogenous Hydrogen Sulfide Promotes Resolution of Colitis in Rats. Wallace JL, Vong L, McKnight W, Dicay M, Martin GR.Gastroenterology. 2009 Aug;137(2):569-78, 578.e1. Epub 2009 Apr 16. 18. Active CBS can be expressed in heme-free systems in the presence of metal-substituted porphyrins or a chemical chaperone. Majtan T, Singh LR, Wang L, Kruger WD, Kraus JP.J Biol Chem. 2008 Dec 12;283(50):34588-95. Epub 2008 Oct 10. 19. Hydrogen sulfide enhances ulcer healing in rats. Wallace JL, Dicay M, McKnight W, Martin GR.FASEB J. 2007 Dec;21(14):4070-6. Epub 2007 Jul 18. 20. Hydrogen sulfide is a novel prosecretory neuromodulator in the Guinea-pig and human colon. Schicho R, Krueger D, Zeller F, Von Weyhern CW, Frieling T, Kimura H, Ishii I, De Giorgio R, Campi B, Schemann M.Gastroenterology. 2006 Nov;131(5):1542-52. Epub 2006 Aug 18.

NCBI and Uniprot Product Information

• NCBI GI #: 4557415
• NCBI GeneID: 875
• NCBI Accession #: NP_000062
• NCBI GenBank Nucleotide #: NM_000071
• UniProt Accession #: P35520; Q99425; Q9BWC5; B2R993; D3DSK4
• Molecular Weight: 61,863 Da
• NCBI Official Full Name: cystathionine beta-synthase
• NCBI Official Synonym Full Names: cystathionine-beta-synthase
• NCBI Official Symbol: CBS
• NCBI Official Synonym Symbols: HIP4
• NCBI Protein Information: cystathionine beta-synthase; beta-thionase; methylcysteine synthase; serine sulfhydrase
• UniProt Protein Name: Cystathionine beta-synthase
• Protein Family: Cystathionine beta-synthase
• UniProt Gene Name: CBS
• UniProt Entry Name: CBS_HUMAN

Uniprot Description

CBS: Only known pyridoxal phosphate-dependent enzyme that contains heme. Important regulator of hydrogen sulfide, especially in the brain, utilizing cysteine instead of serine to catalyze the formation of hydrogen sulfide. Hydrogen sulfide is a gastratransmitter with signaling and cytoprotective effects such as acting as a neuromodulator in the brain to protect neurons against hypoxic injury. Defects in CBS are the cause of cystathionine beta- synthase deficiency (CBSD). CBSD is an enzymatic deficiency resulting in altered sulfur metabolism and homocystinuria. The clinical features of untreated homocystinuria due to CBS deficiency include myopia, ectopia lentis, mental retardation, skeletal anomalies resembling Marfan syndrome, and thromboembolic events. Light skin and hair can also be present. Biochemical features include increased urinary homocystine and methionine. Belongs to the cysteine synthase/cystathionine beta- synthase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Other Amino Acids Metabolism - selenoamino acid; Amino Acid Metabolism - cysteine and methionine; Amino Acid Metabolism - glycine, serine and threonine; Lyase; EC 4.2.1.22

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: intracellular membrane-bound organelle; nucleolus; nucleus; cytosol

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; enzyme binding; cystathionine beta-synthase activity; ubiquitin protein ligase binding; metal ion binding; heme binding; pyridoxal phosphate binding

Biological Process: cysteine biosynthetic process via cystathionine; homocysteine catabolic process; sulfur amino acid metabolic process; L-serine metabolic process; transsulfuration; cysteine biosynthetic process from serine; homocysteine metabolic process; L-serine catabolic process; L-cysteine catabolic process

Disease: Homocystinuria Due To Cystathionine Beta-synthase Deficiency