Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.59kD).)

Mouse anti-Human AKR1B10 Monoclonal Antibody | anti-AKR1B10 antibody

AKR1B10 (Aldo-keto Reductase Family 1 Member B10, ARL-1, Aldose Reductase-like, Aldose Reductase-related Protein, ARP, hARP, Small Intestine Reductase, SI Reductase, AKR1B11) (AP)

Gene Names
AKR1B10; HIS; HSI; ARL1; ARL-1; ALDRLn; AKR1B11; AKR1B12
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AKR1B10; Monoclonal Antibody; AKR1B10 (Aldo-keto Reductase Family 1 Member B10; ARL-1; Aldose Reductase-like; Aldose Reductase-related Protein; ARP; hARP; Small Intestine Reductase; SI Reductase; AKR1B11) (AP); anti-AKR1B10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A6
Specificity
Recognizes human AKR1B10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-AKR1B10 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa76-144 from human AKR1B10 (NP_064695) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.59kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.59kD).)

Western Blot (WB)

(Western Blot analysis of AKR1B10 expression in transfected 293T cell line by AKR1B10 monoclonal antibody. Lane 1: AKR1B10 transfected lysate (36kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AKR1B10 expression in transfected 293T cell line by AKR1B10 monoclonal antibody. Lane 1: AKR1B10 transfected lysate (36kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to AKR1B10 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to AKR1B10 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to AKR1B10 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to AKR1B10 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged AKR1B10 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AKR1B10 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(AKR1B10 monoclonal antibody, Western Blot analysis of AKR1B10 expression in HepG2.)

Western Blot (WB) (AKR1B10 monoclonal antibody, Western Blot analysis of AKR1B10 expression in HepG2.)
Product Categories/Family for anti-AKR1B10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36 kDa (316aa), confirmed by MALDI-TOF.
NCBI Official Full Name
aldo-keto reductase family 1 member B10
NCBI Official Synonym Full Names
aldo-keto reductase family 1 member B10
NCBI Official Symbol
AKR1B10
NCBI Official Synonym Symbols
HIS; HSI; ARL1; ARL-1; ALDRLn; AKR1B11; AKR1B12
NCBI Protein Information
aldo-keto reductase family 1 member B10
UniProt Protein Name
Aldo-keto reductase family 1 member B10
UniProt Gene Name
AKR1B10
UniProt Synonym Gene Names
AKR1B11; ARP; hARP
UniProt Entry Name
AK1BA_HUMAN

NCBI Description

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. [provided by RefSeq, Jul 2008]

Uniprot Description

AKR1B10: Acts as all-trans-retinaldehyde reductase. Can efficiently reduce aliphatic and aromatic aldehydes, and is less active on hexoses (in vitro). May be responsible for detoxification of reactive aldehydes in the digested food before the nutrients are passed on to other organs. Belongs to the aldo/keto reductase family.

Protein type: EC 1.1.1.-; Lipid Metabolism - linoleic acid; EC 1.1.1.21; Carbohydrate Metabolism - butanoate; Oxidoreductase; Carbohydrate Metabolism - fructose and mannose

Chromosomal Location of Human Ortholog: 7q33

Cellular Component: lysosome; cytosol

Molecular Function: protein binding; aldo-keto reductase activity; indanol dehydrogenase activity; geranylgeranyl reductase activity; retinal dehydrogenase activity

Biological Process: steroid metabolic process; phototransduction, visible light; digestion; farnesol catabolic process; aldehyde metabolic process; retinoid metabolic process

Research Articles on AKR1B10

Similar Products

Product Notes

The AKR1B10 akr1b10 (Catalog #AAA6129940) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AKR1B10 (Aldo-keto Reductase Family 1 Member B10, ARL-1, Aldose Reductase-like, Aldose Reductase-related Protein, ARP, hARP, Small Intestine Reductase, SI Reductase, AKR1B11) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AKR1B10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AKR1B10 akr1b10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AKR1B10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.