Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of ADAMTS4 transfected lysate using ADAMTS4 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with ADAMTS4 rabbit polyclonal antibody.)

Mouse anti-Human ADAMTS4 Monoclonal Antibody | anti-ADAMTS4 antibody

ADAMTS4 (A Disintegrin And Metalloproteinase with Thrombospondin Motif 4, ADAM Metallopeptidase with Thrombospondin Type 1 Motif 4, ADAMTS-4, ADAM-TS4, ADAM-TS 4, ADAMTS-4 Precursor, ADMP-1, Aggrecanase I, Aggrecanase 1, KIAA0688, UNQ769/PRO1563) (AP)

Gene Names
ADAMTS4; ADMP-1; ADAMTS-2; ADAMTS-4
Reactivity
Human
Applications
ELISA, Immunoprecipitation
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ADAMTS4; Monoclonal Antibody; ADAMTS4 (A Disintegrin And Metalloproteinase with Thrombospondin Motif 4; ADAM Metallopeptidase with Thrombospondin Type 1 Motif 4; ADAMTS-4; ADAM-TS4; ADAM-TS 4; ADAMTS-4 Precursor; ADMP-1; Aggrecanase I; Aggrecanase 1; KIAA0688; UNQ769/PRO1563) (AP); anti-ADAMTS4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A6
Specificity
Recognizes human ADAMTS4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
4341
Applicable Applications for anti-ADAMTS4 antibody
ELISA (EIA), Immunoprecipitation (IP)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa693-802 from ADAMTS4 (AAH63293) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RKFRYGYNNVVTIPAGATHILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQDTRLRYSFFV
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of ADAMTS4 transfected lysate using ADAMTS4 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with ADAMTS4 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of ADAMTS4 transfected lysate using ADAMTS4 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with ADAMTS4 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged ADAMTS4 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ADAMTS4 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-ADAMTS4 antibody
ADAMTS4 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme lacks a C-terminal TS motif. It is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The cleavage of aggrecan and brevican suggests key roles of this enzyme in arthritic disease and in the central nervous system, potentially, in the progression of glioma.
Product Categories/Family for anti-ADAMTS4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 4, mRNA
NCBI Official Synonym Full Names
ADAM metallopeptidase with thrombospondin type 1 motif 4
NCBI Official Symbol
ADAMTS4
NCBI Official Synonym Symbols
ADMP-1; ADAMTS-2; ADAMTS-4
NCBI Protein Information
A disintegrin and metalloproteinase with thrombospondin motifs 4

NCBI Description

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of this family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene lacks a C-terminal TS motif. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The expression of this gene is upregulated in arthritic disease and this may contribute to disease progression through the degradation of aggrecan. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016]

Research Articles on ADAMTS4

Similar Products

Product Notes

The ADAMTS4 (Catalog #AAA6129886) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ADAMTS4 (A Disintegrin And Metalloproteinase with Thrombospondin Motif 4, ADAM Metallopeptidase with Thrombospondin Type 1 Motif 4, ADAMTS-4, ADAM-TS4, ADAM-TS 4, ADAMTS-4 Precursor, ADMP-1, Aggrecanase I, Aggrecanase 1, KIAA0688, UNQ769/PRO1563) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADAMTS4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ADAMTS4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADAMTS4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.