Mouse anti-Human ADAMTS4 Monoclonal Antibody | anti-ADAMTS4 antibody

ADAMTS4 (A Disintegrin And Metalloproteinase with Thrombospondin Motif 4, ADAM Metallopeptidase with Thrombospondin Type 1 Motif 4, ADAMTS-4, ADAM-TS4, ADAM-TS 4, ADAMTS-4 Precursor, ADMP-1, Aggrecanase I, Aggrecanase 1, KIAA0688, UNQ769/PRO1563) (AP)

Cat. Num. AAA6129886

• Gene Names: ADAMTS4; ADMP-1; ADAMTS-2; ADAMTS-4
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ADAMTS4; Monoclonal Antibody; ADAMTS4 (A Disintegrin And Metalloproteinase with Thrombospondin Motif 4; ADAM Metallopeptidase with Thrombospondin Type 1 Motif 4; ADAMTS-4; ADAM-TS4; ADAM-TS 4; ADAMTS-4 Precursor; ADMP-1; Aggrecanase I; Aggrecanase 1; KIAA0688; UNQ769/PRO1563) (AP); anti-ADAMTS4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A6
• Specificity: Recognizes human ADAMTS4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 4341

• Applicable Applications for anti-ADAMTS4 antibody: ELISA (EIA), Immunoprecipitation (IP)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa693-802 from ADAMTS4 (AAH63293) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RKFRYGYNNVVTIPAGATHILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQDTRLRYSFFV
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of ADAMTS4 transfected lysate using ADAMTS4 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with ADAMTS4 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged ADAMTS4 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-ADAMTS4 antibody

ADAMTS4 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme lacks a C-terminal TS motif. It is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The cleavage of aggrecan and brevican suggests key roles of this enzyme in arthritic disease and in the central nervous system, potentially, in the progression of glioma.

Product Categories/Family for anti-ADAMTS4 antibody

Antibodies; Matrix Metalloproteinases

NCBI and Uniprot Product Information

• NCBI GI #: 38648771
• NCBI GeneID: 9507
• NCBI Official Full Name: Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 4, mRNA
• NCBI Official Synonym Full Names: ADAM metallopeptidase with thrombospondin type 1 motif 4
• NCBI Official Symbol: ADAMTS4
• NCBI Official Synonym Symbols: ADMP-1; ADAMTS-2; ADAMTS-4
• NCBI Protein Information: A disintegrin and metalloproteinase with thrombospondin motifs 4
• Protein Family: A disintegrin and metalloproteinase with thrombospondin motifs

NCBI Description

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of this family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene lacks a C-terminal TS motif. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The expression of this gene is upregulated in arthritic disease and this may contribute to disease progression through the degradation of aggrecan. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016]