Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.96kD).)

Mouse anti-Human SLC22A13 Monoclonal Antibody | anti-SLC22A13 antibody

SLC22A13 (Solute Carrier Family 22 Member 13, Organic Cation Transporter-like 3, OCTL3, ORCTL3, ORCTL-3, OAT10, OCTL1)

Gene Names
SLC22A13; OAT10; OCTL1; OCTL3; ORCTL3; ORCTL-3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SLC22A13; Monoclonal Antibody; SLC22A13 (Solute Carrier Family 22 Member 13; Organic Cation Transporter-like 3; OCTL3; ORCTL3; ORCTL-3; OAT10; OCTL1); Anti -SLC22A13 (Solute Carrier Family 22 Member 13; anti-SLC22A13 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E6
Specificity
Recognizes human SLC22A13.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
AHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLMFRPPPANASLQDILSHRFNETQPCDMGWEYPENRLPSLKNEFNLVCDRKHLKDT
Applicable Applications for anti-SLC22A13 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa38-139 from SLC22A13 (NP_004247) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.96kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.96kD).)

Western Blot (WB)

(SLC22A13 monoclonal antibody Western Blot analysis of SLC22A13 expression in A-431)

Western Blot (WB) (SLC22A13 monoclonal antibody Western Blot analysis of SLC22A13 expression in A-431)

Testing Data

(Detection limit for recombinant GST tagged SLC22A13 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC22A13 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-SLC22A13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,862 Da
NCBI Official Full Name
solute carrier family 22 member 13
NCBI Official Synonym Full Names
solute carrier family 22 (organic anion/urate transporter), member 13
NCBI Official Symbol
SLC22A13
NCBI Official Synonym Symbols
OAT10; OCTL1; OCTL3; ORCTL3; ORCTL-3
NCBI Protein Information
solute carrier family 22 member 13; organic cation transporter-like 3; organic-cation transporter like 3; organic cationic transporter-like 3; solute carrier family 22, member 13; solute carrier family 22 (organic anion transporter), member 13
UniProt Protein Name
Solute carrier family 22 member 13
Protein Family
UniProt Gene Name
SLC22A13
UniProt Synonym Gene Names
ORCTL3; ORCTL-3
UniProt Entry Name
S22AD_HUMAN

NCBI Description

This gene encodes a member of the organic-cation transporter family. It is located in a gene cluster with another member of the family, organic cation transporter like 4. The encoded protein is a transmembrane protein involved in the transport of small molecules. This protein can function to mediate urate uptake and is a high affinity nicotinate exchanger in the kidneys and the intestine. [provided by RefSeq, Sep 2008]

Uniprot Description

SLC22A13: a member of the organic-cation transporter family. It is located in a gene cluster with another member of the family, organic cation transporter like 4. The encoded protein is a transmembrane protein involved in the transport of small molecules. This protein can function to mediate urate uptake and is a high affinity nicotinate exchanger in the kidneys and the intestine. [provided by RefSeq, Sep 2008]

Protein type: Membrane protein, integral; Transporter, SLC family; Transporter; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: integral to plasma membrane; apical plasma membrane

Molecular Function: organic cation transmembrane transporter activity

Biological Process: urate transport; organic cation transport; transmembrane transport

Research Articles on SLC22A13

Similar Products

Product Notes

The SLC22A13 slc22a13 (Catalog #AAA6010922) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC22A13 (Solute Carrier Family 22 Member 13, Organic Cation Transporter-like 3, OCTL3, ORCTL3, ORCTL-3, OAT10, OCTL1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC22A13 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the SLC22A13 slc22a13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AHVFMVLDEP HHCAVAWVKN HTFNLSAAEQ LVLSVPLDTA GHPEPCLMFR PPPANASLQD ILSHRFNETQ PCDMGWEYPE NRLPSLKNEF NLVCDRKHLK DT. It is sometimes possible for the material contained within the vial of "SLC22A13, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.