Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TADA3L expression in transfected 293T cell line by TADA3L polyclonal antibody. Lane 1: TADA3L transfected lysate (41.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human TADA3 Polyclonal Antibody | anti-TADA3 antibody

TADA3 (Transcriptional Adapter 3, ADA3, ADA3 Homolog, hADA3, ADA3-like Protein, NGG1, STAF54, Transcriptional Adapter 3-like, TADA3L)

Gene Names
TADA3; ADA3; NGG1; hADA3; STAF54; TADA3L
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
TADA3; Polyclonal Antibody; TADA3 (Transcriptional Adapter 3; ADA3; ADA3 Homolog; hADA3; ADA3-like Protein; NGG1; STAF54; Transcriptional Adapter 3-like; TADA3L); Anti -TADA3 (Transcriptional Adapter 3; anti-TADA3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TADA3L.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVDALLKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPMEDSPIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHNRTKKHDLLR
Applicable Applications for anti-TADA3 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full-length human TADA3L, aa1-369 (NP_597814.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TADA3L expression in transfected 293T cell line by TADA3L polyclonal antibody. Lane 1: TADA3L transfected lysate (41.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TADA3L expression in transfected 293T cell line by TADA3L polyclonal antibody. Lane 1: TADA3L transfected lysate (41.4kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-TADA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,902 Da
NCBI Official Full Name
transcriptional adapter 3 isoform a
NCBI Official Synonym Full Names
transcriptional adaptor 3
NCBI Official Symbol
TADA3
NCBI Official Synonym Symbols
ADA3; NGG1; hADA3; STAF54; TADA3L
NCBI Protein Information
transcriptional adapter 3; ADA3 homolog; ADA3-like protein
UniProt Protein Name
Transcriptional adapter 3
Protein Family
UniProt Gene Name
TADA3
UniProt Synonym Gene Names
ADA3; TADA3L; hADA3
UniProt Entry Name
TADA3_HUMAN

NCBI Description

DNA-binding transcriptional activator proteins increase the rate of transcription by interacting with the transcriptional machinery bound to the basal promoter in conjunction with adaptor proteins, possibly by acetylation and destabilization of nucleosomes. The protein encoded by this gene is a transcriptional activator adaptor and a component of the histone acetyl transferase (HAT) coactivator complex which plays a crucial role in chromatin modulation and cell cycle progression. Along with the other components of the complex, this protein links transcriptional activators bound to specific promoters, to histone acetylation and the transcriptional machinery. The protein is also involved in the stabilization and activation of the p53 tumor suppressor protein that plays a role in the cellular response to DNA damage. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013]

Uniprot Description

TADA3L: Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex. Also known as a coactivator for p53/TP53-dependent transcriptional activation. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. Belongs to the NGG1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 3p25.3

Cellular Component: nucleoplasm; intracellular; nucleus

Molecular Function: ligand-dependent nuclear receptor binding; protein domain specific binding; protein binding; histone acetyltransferase activity; ligand-dependent nuclear receptor transcription coactivator activity; transcription coactivator activity; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; mitosis; establishment and/or maintenance of chromatin architecture; regulation of protein amino acid phosphorylation; regulation of histone deacetylation; estrogen receptor signaling pathway; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; regulation of protein stability

Research Articles on TADA3

Similar Products

Product Notes

The TADA3 tada3 (Catalog #AAA6010772) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TADA3 (Transcriptional Adapter 3, ADA3, ADA3 Homolog, hADA3, ADA3-like Protein, NGG1, STAF54, Transcriptional Adapter 3-like, TADA3L) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TADA3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the TADA3 tada3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSELKDCPLQ FHDFKSVDHL KVCPRYTAVL ARSEDDGIGI EELDTLQLEL ETLLSSASRR LRVLEAETQI LTDWQDKKGD RRFLKLGRDH ELGAPPKHGK PKKQKLEGKA GHGPGPGPGR PKSKNLQPKI QEYEFTDDPI DVPRIPKNDA PNRFWASVEP YCADITSEEV RTLEELLKPP EDEAEHYKIP PLGKHYSQRW AQEDLLEEQK DGARAAAVAD KKKGLMGPLT ELDTKDVDAL LKKSEAQHEQ PEDGCPFGAL TQRLLQALVE ENIISPMEDS PIPDMSGKES GADGASTSPR NQNKPFSVPH TKSLESRIKE ELIAQGLLES EDRPAEDSED EVLAELRKRQ AELKALSAHN RTKKHDLLR. It is sometimes possible for the material contained within the vial of "TADA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.