Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TADA3L expression in transfected 293T cell line by TADA3L polyclonal antibody. Lane 1: TADA3L transfected lysate (41.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human TADA3 Polyclonal Antibody | anti-TADA3 antibody

TADA3 (Transcriptional Adapter 3, ADA3, ADA3 Homolog, hADA3, ADA3-like Protein, NGG1, STAF54, Transcriptional Adapter 3-like, TADA3L) (AP)

Gene Names
TADA3; ADA3; NGG1; hADA3; STAF54; TADA3L
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TADA3; Polyclonal Antibody; TADA3 (Transcriptional Adapter 3; ADA3; ADA3 Homolog; hADA3; ADA3-like Protein; NGG1; STAF54; Transcriptional Adapter 3-like; TADA3L) (AP); anti-TADA3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TADA3L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
2571
Applicable Applications for anti-TADA3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length human TADA3L, aa1-369 (NP_597814.1).
Immunogen Sequence
MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVDALLKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPMEDSPIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHNRTKKHDLLR
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TADA3L expression in transfected 293T cell line by TADA3L polyclonal antibody. Lane 1: TADA3L transfected lysate (41.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TADA3L expression in transfected 293T cell line by TADA3L polyclonal antibody. Lane 1: TADA3L transfected lysate (41.4kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-TADA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens transcriptional adaptor 3 (TADA3), transcript variant 2, mRNA
NCBI Official Synonym Full Names
transcriptional adaptor 3
NCBI Official Symbol
TADA3
NCBI Official Synonym Symbols
ADA3; NGG1; hADA3; STAF54; TADA3L
NCBI Protein Information
transcriptional adapter 3
Protein Family

NCBI Description

DNA-binding transcriptional activator proteins increase the rate of transcription by interacting with the transcriptional machinery bound to the basal promoter in conjunction with adaptor proteins, possibly by acetylation and destabilization of nucleosomes. The protein encoded by this gene is a transcriptional activator adaptor and a component of the histone acetyl transferase (HAT) coactivator complex which plays a crucial role in chromatin modulation and cell cycle progression. Along with the other components of the complex, this protein links transcriptional activators bound to specific promoters, to histone acetylation and the transcriptional machinery. The protein is also involved in the stabilization and activation of the p53 tumor suppressor protein that plays a role in the cellular response to DNA damage. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013]

Research Articles on TADA3

Similar Products

Product Notes

The TADA3 (Catalog #AAA6395840) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TADA3 (Transcriptional Adapter 3, ADA3, ADA3 Homolog, hADA3, ADA3-like Protein, NGG1, STAF54, Transcriptional Adapter 3-like, TADA3L) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TADA3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TADA3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TADA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.