Mouse anti-Human, Rat PPP1R3B Polyclonal Antibody | anti-PPP1R3B antibody

PPP1R3B (PPP1R4, Protein Phosphatase 1 Regulatory Subunit 3B, Hepatic Glycogen-targeting Protein Phosphatase 1 Regulatory Subunit GL, Protein Phosphatase 1 Regulatory Subunit 4, Protein Phosphatase 1 Subunit GL)

Cat. Num. AAA6009574

• Gene Names: PPP1R3B; GL; PTG; PPP1R4
• Reactivity: Human, Rat
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: PPP1R3B; Polyclonal Antibody; PPP1R3B (PPP1R4; Protein Phosphatase 1 Regulatory Subunit 3B; Hepatic Glycogen-targeting Protein Phosphatase 1 Regulatory Subunit GL; Protein Phosphatase 1 Regulatory Subunit 4; Protein Phosphatase 1 Subunit GL); Anti -PPP1R3B (PPP1R4; anti-PPP1R3B antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human PPP1R3B. Species Crossreactivity: rat.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY

• Applicable Applications for anti-PPP1R3B antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human PPP1R3B, aa1-286 (AAH43388.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PPP1R3B polyclonal antibody. Western Blot analysis of PPP1R3B expression in rat brain.)

Western Blot (WB)

(Western Blot analysis of PPP1R3B expression in transfected 293T cell line by PPP1R3B polyclonal antibody. Lane 1: PPP1R3B transfected lysate (31.46kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to PPP1R3B on HeLa cell. [antibody concentration 10ug/ml].)

Related Product Information for anti-PPP1R3B antibody

The protein phosphatase-1 (PP1) catalytic subunit (PPP1CA; MIM 176875) is regulated by targeting subunits, such as PP1R3B. PP1R3B suppresses the rate at which PP1 dephosphorylates (i.e., inactivates) glycogen phosphorylase (see PYGL; MIM 232700) and enhances the rate at which it activates glycogen synthase (see GYS2; MIM 138571) (Doherty et al., 1995 [PubMed 7498521]).[supplied by OMIM].

Product Categories/Family for anti-PPP1R3B antibody

Antibodies; Abs to Enzymes; Phosphatase

NCBI and Uniprot Product Information

• NCBI GI #: 318037218
• NCBI GeneID: 79660
• NCBI Accession #: NP_001188258.1
• NCBI GenBank Nucleotide #: NM_001201329.1
• UniProt Accession #: Q86XI6; Q9H812; B3KTV3
• Molecular Weight: 32,695 Da
• NCBI Official Full Name: protein phosphatase 1 regulatory subunit 3B
• NCBI Official Synonym Full Names: protein phosphatase 1, regulatory subunit 3B
• NCBI Official Symbol: PPP1R3B
• NCBI Official Synonym Symbols: GL; PTG; PPP1R4
• NCBI Protein Information: protein phosphatase 1 regulatory subunit 3B; PP1 subunit R4; hepatic glycogen-targeting subunit, G(L); protein phosphatase 1 regulatory subunit 4; protein phosphatase 1, regulatory (inhibitor) subunit 3B; hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL
• UniProt Protein Name: Protein phosphatase 1 regulatory subunit 3B
• Protein Family: Protein phosphatase 1 regulatory
• UniProt Gene Name: PPP1R3B
• UniProt Synonym Gene Names: PPP1R4; PP1 subunit R4; PTG
• UniProt Entry Name: PPR3B_HUMAN

NCBI Description

This gene encodes the catalytic subunit of the serine/theonine phosphatase, protein phosphatase-1. The encoded protein is expressed in liver and skeletal muscle tissue and may be involved in regulating glycogen synthesis in these tissues. This gene may be a involved in type 2 diabetes and maturity-onset diabetes of the young. Alternate splicing results in multiple transcript variants that encode the same protein.[provided by RefSeq, Jan 2011]

Uniprot Description

PPP1R3B: Acts as a glycogen-targeting subunit for phosphatase PP1. Facilitates interaction of the PP1 with enzymes of the glycogen metabolism and regulates its activity. Suppresses the rate at which PP1 dephosphorylates (inactivates) glycogen phosphorylase and enhances the rate at which it activates glycogen synthase and therefore limits glycogen breakdown. Its activity is inhibited by PYGL, resulting in inhibition of the glycogen synthase and glycogen phosphorylase phosphatase activities of PP1. Dramatically increases basal and insulin-stimulated glycogen synthesis upon overexpression in hepatocytes.

Protein type: Protein phosphatase, regulatory subunit

Chromosomal Location of Human Ortholog: 8p23.1

Cellular Component: glycogen granule; intracellular membrane-bound organelle; protein phosphatase type 1 complex

Molecular Function: enzyme binding; protein phosphatase regulator activity; phosphoprotein phosphatase activity

Biological Process: glycogen metabolic process; regulation of glycogen catabolic process; dephosphorylation; regulation of catalytic activity; regulation of glycogen biosynthetic process