Rabbit anti-Human TANK Polyclonal Antibody | anti-TANK antibody

TANK (TRAF Family Member-associated NF-kappa-B Activator, TRAF-interacting Protein, ITRAF, I-TRAF, TRAF2) APC

Cat. Num. AAA6395995

• Gene Names: TANK; ITRAF; TRAF2; I-TRAF
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TANK; Polyclonal Antibody; TANK (TRAF Family Member-associated NF-kappa-B Activator; TRAF-interacting Protein; ITRAF; I-TRAF; TRAF2) APC; anti-TANK antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human TANK.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 698

• Applicable Applications for anti-TANK antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human TANK, aa1-119 (NP_597841.1).
• Immunogen Sequence: MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TANK rabbit polyclonal antibody. Western Blot analysis of TANK expression in human liver.)

Western Blot (WB)

(Western Blot analysis of TANK expression in transfected 293T cell line by TANK polyclonal antibody. Lane 1: TANK transfected lysate (13.6kD). Lane 2: Non-transfected lysate. )

Product Categories/Family for anti-TANK antibody

Antibodies; Signal Transduction

References

1. Cheng, G., et al., (1996), "TANK, a co-inducer with TRAF2 of TNF-and CD40L-mediated NF-kappaB activation", Genes Dev., 10: 963-973. 2. Rothe, M., et al., (1996), "I-TRAF is a novel TRAF-interacting protein that regulates TRAF-mediated signal transduction", Proc. Natl. Acad. Sci. USA, 93: 8241-8246. 3. Pomerantz, J.L., et al., (1999), "NF-kappaB activation by a signaling complex containing TRAF2, TANK and TBK1, a novel IKK-related kinase", EMBO J., 18: 6694-6704. 4. Chariot, A., et al., (2002), "Association of the adaptor TANK with the I kappaB kinase (IKK) regulator NEMO connects IKK complexes with the IKK epsilon and TBK1 kinases", J. Biol. Chem., 277: 37029-37036.

NCBI and Uniprot Product Information

• NCBI GI #: 19743570
• NCBI GeneID: 10010
• NCBI Accession #: NM_133484.1
• NCBI GenBank Nucleotide #: NM_133484.1
• UniProt Accession #: Q92844
• NCBI Official Full Name: Homo sapiens TRAF family member associated NFKB activator (TANK), transcript variant 2, mRNA
• NCBI Official Synonym Full Names: TRAF family member associated NFKB activator
• NCBI Official Symbol: TANK
• NCBI Official Synonym Symbols: ITRAF; TRAF2; I-TRAF
• NCBI Protein Information: TRAF family member-associated NF-kappa-B activator
• UniProt Protein Name: TRAF family member-associated NF-kappa-B activator
• Protein Family: Tankyrase
• UniProt Gene Name: TANK
• UniProt Synonym Gene Names: ITRAF; TRAF2; I-TRAF
• UniProt Entry Name: TANK_HUMAN

NCBI Description

The TRAF (tumor necrosis factor receptor-associated factor) family of proteins associate with and transduce signals from members of the tumor necrosis factor receptor superfamily. The protein encoded by this gene is found in the cytoplasm and can bind to TRAF1, TRAF2, or TRAF3, thereby inhibiting TRAF function by sequestering the TRAFs in a latent state in the cytoplasm. For example, the protein encoded by this gene can block TRAF2 binding to LMP1, the Epstein-Barr virus transforming protein, and inhibit LMP1-mediated NF-kappa-B activation. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]

Uniprot Description

TANK: Acts as a regulator of TRAF function by maintaining them in a latent state. Overexpression inhibits TRAF2-mediated NF- kappa-B activation signaled by CD40, TNFR1 and TNFR2. Blocks TRAF2 binding to LMP1 and inhibits LMP1-mediated NF-kappa-B activation. May be involved in I-kappa-B-kinase (IKK) regulation; may function as an adapter for kinases such as TBK1 or IKBKE that can modulate IKK activity. Interacts with TBK1 (via TRAF-C domain). Interacts with TRAF1 (via TRAF-C domain). Interacts with TRAF2 (via TRAF-C domain); the interaction is disrupted by the phosphorylation of TANK by IKBKE. Interacts with TRAF3 (via TRAF-C domain); the interaction with TRAF3 is weaker than the interactions with TRAF1 and TRAF3. Interacts with IKBKG; the interaction is enhanced by IKBKE and TBK1. Part of a ternary complex consisting of TANK, IKBKB and IKBKG. Ubiquitous. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: C2H2-type zinc finger protein; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 2q24.2

Cellular Component: cytoplasm; cytosol

Molecular Function: protein binding; metal ion binding; ubiquitin protein ligase binding

Biological Process: I-kappaB kinase/NF-kappaB cascade; MyD88-independent toll-like receptor signaling pathway; toll-like receptor signaling pathway; innate immune response; toll-like receptor 3 signaling pathway; signal transduction; toll-like receptor 4 signaling pathway