Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MGC29506 expression in transfected 293T cell line by MGC29506 polyclonal aniibody. Lane 1: PACAP transfected lysate (20.9kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human MZB1 Polyclonal Antibody | anti-MZB1 antibody

MZB1 (Marginal Zone B- and B1-cell-specific Protein, Mesenteric Estrogen-dependent Adipose 7, MEDA-7, Plasma Cell-induced Resident Endoplasmic Reticulum Protein, Plasma Cell-induced Resident ER Protein, pERp1, Proapoptotic Caspase Adapter Protein, MEDA7,

Gene Names
MZB1; PACAP; pERp1; MEDA-7
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MZB1; Polyclonal Antibody; MZB1 (Marginal Zone B- and B1-cell-specific Protein; Mesenteric Estrogen-dependent Adipose 7; MEDA-7; Plasma Cell-induced Resident Endoplasmic Reticulum Protein; Plasma Cell-induced Resident ER Protein; pERp1; Proapoptotic Caspase Adapter Protein; MEDA7; ; Anti -MZB1 (Marginal Zone B- and B1-cell-specific Protein; anti-MZB1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PACAP.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL
Applicable Applications for anti-MZB1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human PACAP, aa1-190 (AAH21275).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MGC29506 expression in transfected 293T cell line by MGC29506 polyclonal aniibody. Lane 1: PACAP transfected lysate (20.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MGC29506 expression in transfected 293T cell line by MGC29506 polyclonal aniibody. Lane 1: PACAP transfected lysate (20.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MZB1 antibody
Associates with immunoglobulin M (IgM) heavy and light chains and promotes IgM assembly and secretion. May exert its effect by acting as a molecular chaperone or as an oxidoreductase as it displays a low level of oxidoreductase activity. Isoform 2 may be involved in regulation of apoptosis. Helps to diversify peripheral B-cell functions by regulating Ca2+ stores, antibody secretion and integrin activation.
Product Categories/Family for anti-MZB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,694 Da
NCBI Official Full Name
marginal zone B- and B1-cell-specific protein
NCBI Official Synonym Full Names
marginal zone B and B1 cell-specific protein
NCBI Official Symbol
MZB1
NCBI Official Synonym Symbols
PACAP; pERp1; MEDA-7
NCBI Protein Information
marginal zone B- and B1-cell-specific protein; HSPC190; caspase-2 binding protein; plasma cell-induced ER protein 1; proapoptotic caspase adapter protein; proapoptotic caspase adaptor protein; mesenteric estrogen-dependent adipose 7; plasma cell-induced resident ER protein; mesenteric oestrogen-dependent adipose gene- 7; plasma cell-induced resident endoplasmic reticulum protein
UniProt Protein Name
Marginal zone B- and B1-cell-specific protein
UniProt Gene Name
MZB1
UniProt Synonym Gene Names
MEDA7; PACAP; MEDA-7; Plasma cell-induced resident ER protein; pERp1
UniProt Entry Name
MZB1_HUMAN

Uniprot Description

MEDA-7: Associates with immunoglobulin M (IgM) heavy and light chains and promotes IgM assembly and secretion. May exert its effect by acting as a molecular chaperone or as an oxidoreductase as it displays a low level of oxidoreductase activity. Isoform 2 may be involved in regulation of apoptosis. Belongs to the PERP1 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Cytokine; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 5q31.2

Cellular Component: endoplasmic reticulum lumen; cytoplasm; extracellular region

Molecular Function: protein binding

Biological Process: integrin activation; apoptosis; positive regulation of cell proliferation; regulation of B cell proliferation; positive regulation of immunoglobulin biosynthetic process; regulation of cell proliferation

Research Articles on MZB1

Similar Products

Product Notes

The MZB1 mzb1 (Catalog #AAA6008077) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MZB1 (Marginal Zone B- and B1-cell-specific Protein, Mesenteric Estrogen-dependent Adipose 7, MEDA-7, Plasma Cell-induced Resident Endoplasmic Reticulum Protein, Plasma Cell-induced Resident ER Protein, pERp1, Proapoptotic Caspase Adapter Protein, MEDA7, reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MZB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the MZB1 mzb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRLSLPLLLL LLGAWAIPGG LGDRAPLTAT APQLDDEEMY SAHMPAHLRC DACRAVAYQM WQNLAKAETK LHTSNSGGRR ELSELVYTDV LDRSCSRNWQ DYGVREVDQV KRLTGPGLSE GPEPSISVMV TGGPWPTRLS RTCLHYLGEF GEDQIYEAHQ QGRGALEALL CGGPQGACSE KVSATREEL. It is sometimes possible for the material contained within the vial of "MZB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.