Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (UBE2V1 polyclonal antibody. Western Blot analysis of UBE2V1 expression in human pancreas.)

Mouse anti-Human UBE2V1 Polyclonal Antibody | anti-UBE2V1 antibody

UBE2V1 (Ubiquitin-conjugating Enzyme E2 Variant 1, UEV-1, CROC-1, TRAF6-Regulated IKK Activator 1 beta Uev1A, CROC1, UBE2V, UEV1, P/OKcl.19)

Gene Names
UBE2V1; CIR1; UEV1; CROC1; UBE2V; UEV-1; UEV1A; CROC-1
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
UBE2V1; Polyclonal Antibody; UBE2V1 (Ubiquitin-conjugating Enzyme E2 Variant 1; UEV-1; CROC-1; TRAF6-Regulated IKK Activator 1 beta Uev1A; CROC1; UBE2V; UEV1; P/OKcl.19); Anti -UBE2V1 (Ubiquitin-conjugating Enzyme E2 Variant 1; anti-UBE2V1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human UBE2V1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN
Applicable Applications for anti-UBE2V1 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human UBE2V1, aa1-148 (AAH00468).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(UBE2V1 polyclonal antibody. Western Blot analysis of UBE2V1 expression in human pancreas.)

Western Blot (WB) (UBE2V1 polyclonal antibody. Western Blot analysis of UBE2V1 expression in human pancreas.)

Western Blot (WB)

(Western Blot analysis of UBE2V1 expression in transfected 293T cell line by UBE2V1 polyclonal antibody. Lane 1: UBE2V1 transfected lysate (16.28kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of UBE2V1 expression in transfected 293T cell line by UBE2V1 polyclonal antibody. Lane 1: UBE2V1 transfected lysate (16.28kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to UBE2V1 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of purified antibody to UBE2V1 on HeLa cell. [antibody concentration 10ug/ml])
Related Product Information for anti-UBE2V1 antibody
Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene is located in the nucleus and can cause transcriptional activation of the human FOS proto-oncogene. It is thought to be involved in the control of differentiation by altering cell cycle behavior. Multiple alternatively spliced transcripts encoding different isoforms have been described for this gene. A pseudogene has been identified which is also located on chromosome 20. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (Kua-UEV), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.
Product Categories/Family for anti-UBE2V1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16,495 Da
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 variant 1 isoform i
NCBI Official Synonym Full Names
ubiquitin-conjugating enzyme E2 variant 1
NCBI Official Symbol
UBE2V1
NCBI Official Synonym Symbols
CIR1; UEV1; CROC1; UBE2V; UEV-1; UEV1A; CROC-1
NCBI Protein Information
ubiquitin-conjugating enzyme E2 variant 1; DNA-binding protein; TRAF6-regulated IKK activator 1 beta Uev1A
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 variant 1
UniProt Gene Name
UBE2V1
UniProt Synonym Gene Names
CROC1; UBE2V; UEV1; UEV-1
UniProt Entry Name
UB2V1_HUMAN

NCBI Description

Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene is located in the nucleus and can cause transcriptional activation of the human FOS proto-oncogene. It is thought to be involved in the control of differentiation by altering cell cycle behavior. Alternatively spliced transcript variants encoding multiple isoforms have been described for this gene, and multiple pseudogenes of this gene have been identified. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (Kua-UEV), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Apr 2012]

Uniprot Description

UBE2V1: Has no ubiquitin ligase activity on its own. The UBE2V1- UBE2N heterodimer catalyzes the synthesis of non-canonical poly- ubiquitin chains that are linked through Lys-63. This type of poly-ubiquitination activates IKK and does not seem to involve protein degradation by the proteasome. Plays a role in the activation of NF-kappa-B mediated by IL1B, TNF, TRAF6 and TRAF2. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Belongs to the ubiquitin-conjugating enzyme family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 20q13.2

Cellular Component: protein complex; ubiquitin conjugating enzyme complex; cytoplasm; cytosol; nucleus; ubiquitin ligase complex

Molecular Function: protein binding; small conjugating protein ligase activity; ubiquitin conjugating enzyme binding; ubiquitin protein ligase binding

Biological Process: protein polyubiquitination; positive regulation of I-kappaB kinase/NF-kappaB cascade; error-free postreplication DNA repair; postreplication repair; positive regulation of transcription, DNA-dependent; T cell receptor signaling pathway; toll-like receptor 2 signaling pathway; activation of NF-kappaB transcription factor; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; regulation of DNA repair; MyD88-dependent toll-like receptor signaling pathway; regulation of transcription, DNA-dependent; toll-like receptor signaling pathway; innate immune response; toll-like receptor 9 signaling pathway; cell differentiation; toll-like receptor 4 signaling pathway

Research Articles on UBE2V1

Similar Products

Product Notes

The UBE2V1 ube2v1 (Catalog #AAA6004386) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBE2V1 (Ubiquitin-conjugating Enzyme E2 Variant 1, UEV-1, CROC-1, TRAF6-Regulated IKK Activator 1 beta Uev1A, CROC1, UBE2V, UEV1, P/OKcl.19) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2V1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the UBE2V1 ube2v1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAATTGSGVK VPRNFRLLEE LEEGQKGVGD GTVSWGLEDD EDMTLTRWTG MIIGPPRTIY ENRIYSLKIE CGPKYPEAPP FVRFVTKINM NGVNSSNGVV DPRAISVLAK WQNSYSIKVV LQELRRLMMS KENMKLPQPP EGQCYSN. It is sometimes possible for the material contained within the vial of "UBE2V1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.