Mouse anti-Human PBK Monoclonal Antibody

PBK (Lymphokine-activated Killer T-cell-originated Protein Kinase, Cancer/Testis Antigen 84, CT84, MAPKK-like Protein Kinase, Nori-3, PDZ-binding Kinase, Spermatogenesis-related Protein Kinase, SPK, T-LAK Cell-originated Protein Kinase, TOPK, FLJ14385)

Cat. Num. AAA6001445

• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: PBK; Monoclonal Antibody; PBK (Lymphokine-activated Killer T-cell-originated Protein Kinase; Cancer/Testis Antigen 84; CT84; MAPKK-like Protein Kinase; Nori-3; PDZ-binding Kinase; Spermatogenesis-related Protein Kinase; SPK; T-LAK Cell-originated Protein Kinase; TOPK; FLJ14385); Anti -PBK (Lymphokine-activated Killer T-cell-originated Protein Kinase; anti-PBK antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3A11
• Specificity: Recognizes human PBK.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGS

• Applicable Applications for anti-PBK antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunofluorescence: 10ug/ml; Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Partial recombinant corresponding to aa1-110 from human PBK (AAH15191) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PBK monoclonal antibody. Western Blot analysis of PBK expression in human skeletal muscle.)

Western Blot (WB)

(PBK monoclonal antibody, Western Blot analysis of PBK expression in A-431.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PBK on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PBK on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged PBK is ~1ng/ml as a capture antibody.)

Related Product Information for anti-PBK antibody

Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization and attenuation of G2/M checkpoint during doxorubicin-induced DNA damage.

Product Categories/Family for anti-PBK antibody

Antibodies; Abs to Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 117616892
• NCBI Official Full Name: PBK
• Protein Family: Lymphokine-activated killer T-cell-originated protein kinase