Rabbit anti-Human FGL2 Polyclonal Antibody | anti-FGL2 antibody

FGL2 (Fibroleukin, Fibrinogen-like Protein 2, pT49)

Cat. Num. AAA6000194

• Gene Names: FGL2; T49; pT49
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: FGL2; Polyclonal Antibody; FGL2 (Fibroleukin; Fibrinogen-like Protein 2; pT49); Anti -FGL2 (Fibroleukin; anti-FGL2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human FGL2.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MKLANWYWLSSAVLATYGFLVVANNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP

• Applicable Applications for anti-FGL2 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human FGL2, aa1-439 (NP_006673.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FGL2 expression in HeLa using MBS6000194.)

Western Blot (WB)

(Western Blot analysis of FGL2 expression in transfected 293T cell line by MBS6000194. Lane 1: FGL2 transfected lysate (50.2kD) Lane 2: Non-transfected lysate)

Related Product Information for anti-FGL2 antibody

May play a role in physiologic lymphocyte functions at mucosal sites.

Product Categories/Family for anti-FGL2 antibody

Antibodies; Abs to Fibrinogen

NCBI and Uniprot Product Information

• NCBI GI #: 5730075
• NCBI GeneID: 10875
• NCBI Accession #: NP_006673.1
• NCBI GenBank Nucleotide #: NM_006682.2
• UniProt Accession #: Q14314
• Molecular Weight: 50,229 Da
• NCBI Official Full Name: fibroleukin
• NCBI Official Synonym Full Names: fibrinogen-like 2
• NCBI Official Symbol: FGL2
• NCBI Official Synonym Symbols: T49; pT49
• NCBI Protein Information: fibroleukin; fibrinogen-like protein 2
• UniProt Protein Name: Fibroleukin
• Protein Family: Fibroleukin
• UniProt Gene Name: FGL2
• UniProt Entry Name: FGL2_HUMAN

NCBI Description

The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites. [provided by RefSeq, Jul 2008]

Uniprot Description

FGL2: May play a role in physiologic lymphocyte functions at mucosal sites.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: fibrinogen complex