Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Fibroleukin Recombinant Protein | FGL2 recombinant protein

Recombinant Human Fibroleukin

Gene Names
FGL2; T49; pT49
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fibroleukin; Recombinant Human Fibroleukin; FGL2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-439aa; Full Length
Sequence
NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP
Sequence Length
439
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for FGL2 recombinant protein
May play a role in physiologic lymphocyte functions at mucosal sites
Product Categories/Family for FGL2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49.6 kDa
NCBI Official Full Name
fibroleukin
NCBI Official Synonym Full Names
fibrinogen like 2
NCBI Official Symbol
FGL2
NCBI Official Synonym Symbols
T49; pT49
NCBI Protein Information
fibroleukin
UniProt Protein Name
Fibroleukin
Protein Family
UniProt Gene Name
FGL2
UniProt Entry Name
FGL2_HUMAN

NCBI Description

The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites. [provided by RefSeq, Jul 2008]

Uniprot Description

FGL2: May play a role in physiologic lymphocyte functions at mucosal sites.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: fibrinogen complex

Research Articles on FGL2

Similar Products

Product Notes

The FGL2 fgl2 (Catalog #AAA1415882) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-439aa; Full Length. The amino acid sequence is listed below: NNETEEIKDE RAKDVCPVRL ESRGKCEEAG ECPYQVSLPP LTIQLPKQFS RIEEVFKEVQ NLKEIVNSLK KSCQDCKLQA DDNGDPGRNG LLLPSTGAPG EVGDNRVREL ESEVNKLSSE LKNAKEEINV LHGRLEKLNL VNMNNIENYV DSKVANLTFV VNSLDGKCSK CPSQEQIQSR PVQHLIYKDC SDYYAIGKRS SETYRVTPDP KNSSFEVYCD METMGGGWTV LQARLDGSTN FTRTWQDYKA GFGNLRREFW LGNDKIHLLT KSKEMILRID LEDFNGVELY ALYDQFYVAN EFLKYRLHVG NYNGTAGDAL RFNKHYNHDL KFFTTPDKDN DRYPSGNCGL YYSSGWWFDA CLSANLNGKY YHQKYRGVRN GIFWGTWPGV SEAHPGGYKS SFKEAKMMIR PKHFKP. It is sometimes possible for the material contained within the vial of "Fibroleukin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.