Mouse anti-Human LCRMP4 Monoclonal Antibody | anti-LCRMP antibody
Anti-LCRMP4, 5H5
Below is the amino acid sequence:
masgrrgwdssheddlpvylarpgttdqvprqkyggmfcnvegafesktldfdalsvgqrgaktprsgqgsdrgsgsrpgiegdtprrgqgreesrepapaspapagveirsatgkevlqnlgpkdk.
CRMP4 belongs to the collapsin response mediator protein (CRMP) family that includes CRMP 1-5. CRMPs are highly expressed in the nervous system during brain development. It is also found that CRMP4 is inversely associated with lymph node metastasis of prostate cancers and that the methylation of the CpG island within the promoter region of CRMP4 gene down- regulates CRMP4 expression (Xin Gao et al. 2010; Ke Li et al. 2015). Recently, Dr. Xin Gao's lab found that a long-form CRMP4 (LCRMP4) is potentially useful as a serum biomarker for prostate cancers.
Similar Products
Product Notes
The LCRMP (Catalog #AAA592474) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-LCRMP4, 5H5 reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LCRMP4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Sandwich ELISA: In combination with human IL-18 capture antibody clone 2A10 (MBS592448), this biotin labeled anti-human IL-18 antibody clone 10H4 can be used for quantitative detection of human IL-18 levels in Sandwich ELISA application. Researchers should empirically determine the suitability of the LCRMP for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LCRMP4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.