Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Figure 1: Immunohistochemistry on frozen section of human kidney )

Mouse anti-Human Integrin alpha 3A Monoclonal Antibody | anti-Itga3 antibody

Mouse anti Integrin alpha 3A

Gene Names
Itga3; CD49C; GAPB3; AA407068
Reactivity
Human
Applications
Immunocytochemistry, Immunohistochemistry, Immunohistochemistry, Western Blot
Synonyms
Integrin alpha 3A; Monoclonal Antibody; Mouse anti Integrin alpha 3A; anti-Itga3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1
Clone Number
29A3
Specificity
29A3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart.
Form/Format
Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.
Applicable Applications for anti-Itga3 antibody
Immunocytochemistry (IHC), Immunohistochemistry (IHC) (frozen), Western Blot (WB)
Application Notes
29A3 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titRation; recommended range is 1:100 - 1:200 for immunohistochemistry with avidin-biotinylated Horseradish peroxidase complex (ABC) as detection reagent, and 1:100 - 1:1000 for immunoblotting appliCations.
Source Note
29A3 is a Mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Reactivity Note
A broad species reactivity is expected because of the conserved nature of the epitope.
Preparation and Storage
Store at 4 degree C, or in small aliquots at -20 degree C.

Testing Data

(Figure 1: Immunohistochemistry on frozen section of human kidney )

Testing Data (Figure 1: Immunohistochemistry on frozen section of human kidney )
Related Product Information for anti-Itga3 antibody
Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits alpha3 and alpha6, two cytoplasmic variants, A and B, have been identified.
Product Categories/Family for anti-Itga3 antibody
References
Delwel, G. O., de Melker, A. A., Hogervorst, F., Jaspars, L. H., Fles, D. L., Kuikman, I., Lindblom, A., Paulsson, M., Timpl, R., and Sonnenberg, A. (1994). Distinct and overlapping ligand specificities of the alpha 3A beta 1 and alpha 6A beta 1 integrins: recognition of laminin isoforms, Mol Biol Cell 5, 203-15. de Melker, A. A., Sterk, L. M., Delwel, G. O., Fles, D. L., Daams, H., Weening, J. J., and Sonnenberg, A. (1997). The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization, Lab Invest 76, 547-63.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
116,745 Da
NCBI Official Full Name
integrin alpha 3A
NCBI Official Synonym Full Names
integrin alpha 3
NCBI Official Symbol
Itga3
NCBI Official Synonym Symbols
CD49C; GAPB3; AA407068
NCBI Protein Information
integrin alpha-3; VLA-3 alpha 3; alpha3-integrin; galactoprotein B3; VLA-3 subunit alpha; VLA-3 receptor, alpha 3 subunit; CD49 antigen-like family member C
UniProt Protein Name
Integrin alpha-3
Protein Family
UniProt Gene Name
Itga3
UniProt Synonym Gene Names
GAPB3
UniProt Entry Name
ITA3_MOUSE

NCBI Description

This gene encodes a subunit of integrin family of cell surface proteins. The encoded protein undergoes post-translational processing to form a disulfide bond-linked dimer comprised of heavy and light chains. At the cell surface, the encoded protein non-covalently associates with the integrin beta-1 subunit to form a heterodimer that interacts with many extracellular matrix proteins including fibronectin and laminin. Mice lacking the encoded protein die during the first day after birth due to severe abnormalities in kidneys. Mice lacking the encoded protein specifically in the basal layer of epidermis display several skin defects and accelerated wound healing. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]

Uniprot Description

ITGA3: an integral membrane protein that heterodimerizes with a beta chain, forming a receptor for many extracellular-matrix proteins including fibronectin, laminin, collagen, epiligrin and thrombospondin. Undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1. Two alternatively spliced isoforms have been described.

Protein type: Cell adhesion; Receptor, misc.; Membrane protein, integral; Motility/polarity/chemotaxis

Cellular Component: filopodium membrane; focal adhesion; cell surface; basolateral plasma membrane; integral to membrane; excitatory synapse; growth cone; cell projection; membrane; perinuclear region of cytoplasm; plasma membrane; synapse; integrin complex; cell junction; receptor complex; external side of plasma membrane

Molecular Function: integrin binding; collagen binding; protein domain specific binding; protein binding; protease binding; protein heterodimerization activity; fibronectin binding; laminin binding; glycoprotein binding

Biological Process: integrin-mediated signaling pathway; skin development; regulation of transforming growth factor beta receptor signaling pathway; fusion of sperm to egg plasma membrane; negative regulation of Rho protein signal transduction; regulation of BMP signaling pathway; regulation of Wnt receptor signaling pathway; neuron migration; cell adhesion; memory; negative regulation of cell projection organization and biogenesis; lung development

Research Articles on Itga3

Similar Products

Product Notes

The Itga3 itga3 (Catalog #AAA570166) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Mouse anti Integrin alpha 3A reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Integrin alpha 3A can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (IHC), Immunohistochemistry (IHC) (frozen), Western Blot (WB). 29A3 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titRation; recommended range is 1:100 - 1:200 for immunohistochemistry with avidin-biotinylated Horseradish peroxidase complex (ABC) as detection reagent, and 1:100 - 1:1000 for immunoblotting appliCations. Researchers should empirically determine the suitability of the Itga3 itga3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Integrin alpha 3A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.