Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (KCNS1 antibody (MBS5303267) used at 1 ug/ml to detect target protein.)

Rabbit KCNS1 Polyclonal Antibody | anti-KCNS1 antibody

KCNS1 antibody

Gene Names
KCNS1; KV9.1
Applications
Western Blot
Purity
Affinity purified
Synonyms
KCNS1; Polyclonal Antibody; KCNS1 antibody; Polyclonal KCNS1; Anti-KCNS1; KV9.1; Potassium Voltage-Gated Channel Delayed-Rectifier Subfamily S Member 1; KCNS-1; KCNS 1; anti-KCNS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
KCNS1 antibody was raised against the N terminal of KCNS1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNS1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
526
Applicable Applications for anti-KCNS1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Voltage-gated potassium channels form the largest and most diversified class of ion channels and are present in both excitable and nonexcitable cells. Their main functions are associated with the regulation of the resting membrane potential and the control of the shape and frequency of action potentials. The alpha subunits are of 2 types: those that are functional by themselves and those that are electrically silent but capable of modulating the activity of specific functional alpha subunits. KCNS1 is not functional by itself but can form heteromultimers with member 1 and with member 2 (and possibly other members) of the Shab-related subfamily of potassium voltage-gated channel proteins.
Cross-Reactivity
Human
Immunogen
KCNS1 antibody was raised using the N terminal of KCNS1 corresponding to a region with amino acids LMLLVRGTHYENLRSKVVLPTPLGGRSTETFVSEFPGPDTGIRWRRSDEA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(KCNS1 antibody (MBS5303267) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (KCNS1 antibody (MBS5303267) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-KCNS1 antibody
Rabbit polyclonal KCNS1 antibody raised against the N terminal of KCNS1
Product Categories/Family for anti-KCNS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
58 kDa (MW of target protein)
NCBI Official Full Name
KCNS1 protein
NCBI Official Synonym Full Names
potassium voltage-gated channel, modifier subfamily S, member 1
NCBI Official Symbol
KCNS1
NCBI Official Synonym Symbols
KV9.1
NCBI Protein Information
potassium voltage-gated channel subfamily S member 1
UniProt Protein Name
Potassium voltage-gated channel subfamily S member 1
UniProt Gene Name
KCNS1
UniProt Entry Name
KCNS1_HUMAN

NCBI Description

Voltage-gated potassium channels form the largest and most diversified class of ion channels and are present in both excitable and nonexcitable cells. Their main functions are associated with the regulation of the resting membrane potential and the control of the shape and frequency of action potentials. The alpha subunits are of 2 types: those that are functional by themselves and those that are electrically silent but capable of modulating the activity of specific functional alpha subunits. The protein encoded by this gene is not functional by itself but can form heteromultimers with member 1 and with member 2 (and possibly other members) of the Shab-related subfamily of potassium voltage-gated channel proteins. This gene belongs to the S subfamily of the potassium channel family. [provided by RefSeq, Jul 2008]

Uniprot Description

Kv9.1: Potassium channel subunit. Modulates channel activity and reduces the ion flow. Belongs to the potassium channel family. S (TC 1.A.1.2) subfamily. Kv9.1/KCNS1 sub-subfamily.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Channel, potassium

Chromosomal Location of Human Ortholog: 20q12

Cellular Component: voltage-gated potassium channel complex; plasma membrane

Molecular Function: protein binding; potassium channel regulator activity; delayed rectifier potassium channel activity

Biological Process: synaptic transmission; potassium ion transport; protein homooligomerization

Research Articles on KCNS1

Similar Products

Product Notes

The KCNS1 kcns1 (Catalog #AAA5303267) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's KCNS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the KCNS1 kcns1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KCNS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.