Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Serglycin antibody (MBS5303233) used at 1 ug/ml to detect target protein.)

Rabbit Serglycin Polyclonal Antibody | anti-SRGN antibody

Serglycin antibody

Gene Names
SRGN; PPG; PRG; PRG1
Applications
Western Blot
Purity
Affinity purified
Synonyms
Serglycin; Polyclonal Antibody; Serglycin antibody; Polyclonal Serglycin; Anti-Serglycin; FLJ12930; PPG; PRG; MGC9289; PRG1; SRGN; anti-SRGN antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Serglycin antibody was raised against the middle region of SRGN
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SRGN antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
158
Applicable Applications for anti-SRGN antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
SRGN is a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. SRGN was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis.
Cross-Reactivity
Human
Immunogen
Serglycin antibody was raised using the middle region of SRGN corresponding to a region with amino acids RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Serglycin antibody (MBS5303233) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Serglycin antibody (MBS5303233) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-SRGN antibody
Rabbit polyclonal Serglycin antibody raised against the middle region of SRGN
Product Categories/Family for anti-SRGN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
15 kDa (MW of target protein)
NCBI Official Full Name
serglycin
NCBI Official Synonym Full Names
serglycin
NCBI Official Symbol
SRGN
NCBI Official Synonym Symbols
PPG; PRG; PRG1
NCBI Protein Information
serglycin
UniProt Protein Name
Serglycin
Protein Family
UniProt Gene Name
SRGN
UniProt Synonym Gene Names
PRG; PRG1; P.PG
UniProt Entry Name
SRGN_HUMAN

NCBI Description

This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. This encoded protein was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. Two transcript variants, only one of them protein-coding, have been found for this gene. [provided by RefSeq, Jul 2010]

Uniprot Description

SRGN: Plays a role in formation of mast cell secretory granules and mediates storage of various compounds in secretory vesicles. Required for storage of some proteases in both connective tissue and mucosal mast cells and for storage of granzyme B in T-lymphocytes. Plays a role in localizing neutrophil elastase in azurophil granules of neutrophils. Mediates processing of MMP2. Plays a role in cytotoxic cell granule-mediated apoptosis by forming a complex with granzyme B which is delivered to cells by perforin to induce apoptosis. Regulates the secretion of TNF- alpha and may also regulate protease secretion. Inhibits bone mineralization. Belongs to the serglycin family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 10q22.1

Cellular Component: Golgi membrane; Golgi apparatus; extracellular space; mast cell granule; extracellular region

Molecular Function: collagen binding; protein binding

Biological Process: maintenance of granzyme B localization in T cell secretory granule; negative regulation of bone mineralization; platelet activation; platelet degranulation; induction of apoptosis by granzyme; biomineral formation; negative regulation of cytokine secretion; T cell secretory granule organization and biogenesis; mast cell secretory granule organization and biogenesis; protein processing; maintenance of protease localization in mast cell secretory granule; blood coagulation

Research Articles on SRGN

Similar Products

Product Notes

The SRGN srgn (Catalog #AAA5303233) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Serglycin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the SRGN srgn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Serglycin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.