Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit HS6ST3 Polyclonal Antibody | anti-HS6ST3 antibody

HS6ST3 antibody

Gene Names
HS6ST3; HS6ST-3
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
HS6ST3; Polyclonal Antibody; HS6ST3 antibody; Polyclonal HS6ST3; Anti-HS6ST3; Heparan Sulfate 6-O-Sulfotransferase 3; DKFZp761K2315; anti-HS6ST3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
HS6ST3 antibody was raised against the C terminal of HS6ST3
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HS6ST3 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
471
Applicable Applications for anti-HS6ST3 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Heparan sulfate (HS) sulfotransferases, such as HS6ST3, modify HS to generate structures required for interactions between HS and a variety of proteins. These interactions are implicated in proliferation and differentiation, adhesion, migration, inflammation, blood coagulation, and other diverse processes.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
HS6ST3 antibody was raised using the C terminal of HS6ST3 corresponding to a region with amino acids TKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-HS6ST3 antibody
Rabbit polyclonal HS6ST3 antibody raised against the C terminal of HS6ST3
Product Categories/Family for anti-HS6ST3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
55 kDa (MW of target protein)
NCBI Official Full Name
heparan sulfate 6-O-sulfotransferase 3
NCBI Official Synonym Full Names
heparan sulfate 6-O-sulfotransferase 3
NCBI Official Symbol
HS6ST3
NCBI Official Synonym Symbols
HS6ST-3
NCBI Protein Information
heparan-sulfate 6-O-sulfotransferase 3
UniProt Protein Name
Heparan-sulfate 6-O-sulfotransferase 3
UniProt Gene Name
HS6ST3
UniProt Synonym Gene Names
HS6ST-3
UniProt Entry Name
H6ST3_HUMAN

NCBI Description

Heparan sulfate (HS) sulfotransferases, such as HS6ST3, modify HS to generate structures required for interactions between HS and a variety of proteins. These interactions are implicated in proliferation and differentiation, adhesion, migration, inflammation, blood coagulation, and other diverse processes (Habuchi et al., 2000 [PubMed 10644753]).[supplied by OMIM, Mar 2008]

Uniprot Description

HS6ST3: 6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate. Belongs to the sulfotransferase 6 family.

Protein type: EC 2.8.2.-; Transferase; Membrane protein, integral; Glycan Metabolism - heparan sulfate biosynthesis

Chromosomal Location of Human Ortholog: 13q32.1

Cellular Component: integral to membrane

Molecular Function: heparan sulfate 6-O-sulfotransferase activity

Biological Process: heparan sulfate proteoglycan biosynthetic process, enzymatic modification

Research Articles on HS6ST3

Similar Products

Product Notes

The HS6ST3 hs6st3 (Catalog #AAA5303066) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HS6ST3 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HS6ST3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the HS6ST3 hs6st3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HS6ST3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.