Western Blot (WB)
(LANCL2 antibody (MBS5302626) used at 1 ug/ml to detect target protein.)
Rabbit LANCL2 Polyclonal Antibody | anti-LANCL2 antibody
LANCL2 antibody
Gene Names
LANCL2; TASP; GPR69B
Applications
Western Blot
Purity
Affinity purified
Synonyms
LANCL2; Polyclonal Antibody; LANCL2 antibody; Polyclonal LANCL2; Anti-LANCL2; Lanc Lantibiotic Synthetase Component C-Like 2; LANCL-2; TASP; MGC87139; LANCL 2; GPR69B; anti-LANCL2 antibody
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LANCL2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
450
Applicable Applications for anti-LANCL2 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
LANCL2 is necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.
Cross-Reactivity
Human
Immunogen
LANCL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(LANCL2 antibody (MBS5302626) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(LANCL2 antibody (MBS5302626) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-LANCL2 antibody
Rabbit polyclonal LANCL2 antibody
Product Categories/Family for anti-LANCL2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51 kDa (MW of target protein)
NCBI Official Full Name
lanC-like protein 2
NCBI Official Synonym Full Names
LanC lantibiotic synthetase component C-like 2 (bacterial)
NCBI Official Symbol
LANCL2
NCBI Official Synonym Symbols
TASP; GPR69B
NCBI Protein Information
lanC-like protein 2
UniProt Protein Name
LanC-like protein 2
Protein Family
UniProt Gene Name
LANCL2
UniProt Synonym Gene Names
GPR69B; TASP
UniProt Entry Name
LANC2_HUMAN
Uniprot Description
LANCL2: Necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes. Belongs to the LanC-like protein family.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 7q31.1-q31.33
Cellular Component: cortical actin cytoskeleton; cytoplasm; plasma membrane; nucleus; cytosol
Molecular Function: GTP binding; phosphatidylinositol-5-phosphate binding; catalytic activity; phosphatidylinositol 3-phosphate binding; ATP binding
Biological Process: metabolic process; positive regulation of abscisic acid mediated signaling; negative regulation of transcription, DNA-dependent
Research Articles on LANCL2
Similar Products
Product Notes
The LANCL2 lancl2 (Catalog #AAA5302626) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's LANCL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the LANCL2 lancl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LANCL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
