Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (LANCL2 polyclonal antibody. Western Blot analysis of LANCL2 expression in A-431.)

Mouse anti-Human LANCL2 Polyclonal Antibody | anti-LANCL2 antibody

LANCL2 (LanC-like Protein 2, Testis-specific Adriamycin Sensitivity Protein, GPR69B, TASP, MGC87139)

Gene Names
LANCL2; TASP; GPR69B
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
LANCL2; Polyclonal Antibody; LANCL2 (LanC-like Protein 2; Testis-specific Adriamycin Sensitivity Protein; GPR69B; TASP; MGC87139); Anti -LANCL2 (LanC-like Protein 2; anti-LANCL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LANCL2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MGETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATTDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFELDSSKRD
Applicable Applications for anti-LANCL2 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human LANCL2, aa1-450 (NP_061167.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(LANCL2 polyclonal antibody. Western Blot analysis of LANCL2 expression in A-431.)

Western Blot (WB) (LANCL2 polyclonal antibody. Western Blot analysis of LANCL2 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of LANCL2 expression in transfected 293T cell line by LANCL2 polyclonal antibody. Lane 1: LANCL2 transfected lysate (49.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LANCL2 expression in transfected 293T cell line by LANCL2 polyclonal antibody. Lane 1: LANCL2 transfected lysate (49.5kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to LANCL2 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of purified antibody to LANCL2 on HeLa cell. [antibody concentration 10ug/ml].)
Related Product Information for anti-LANCL2 antibody
Necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.
Product Categories/Family for anti-LANCL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,854 Da
NCBI Official Full Name
lanC-like protein 2
NCBI Official Synonym Full Names
LanC lantibiotic synthetase component C-like 2 (bacterial)
NCBI Official Symbol
LANCL2
NCBI Official Synonym Symbols
TASP; GPR69B
NCBI Protein Information
lanC-like protein 2; G protein-coupled receptor 69B; testis-specific adriamycin sensitivity protein; LanC (bacterial lantibiotic synthetase component C)-like 2
UniProt Protein Name
LanC-like protein 2
Protein Family
UniProt Gene Name
LANCL2
UniProt Synonym Gene Names
GPR69B; TASP
UniProt Entry Name
LANC2_HUMAN

Uniprot Description

LANCL2: Necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes. Belongs to the LanC-like protein family.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 7q31.1-q31.33

Cellular Component: cortical actin cytoskeleton; cytoplasm; plasma membrane; nucleus; cytosol

Molecular Function: GTP binding; phosphatidylinositol-5-phosphate binding; catalytic activity; ATP binding; phosphatidylinositol 3-phosphate binding

Biological Process: metabolic process; positive regulation of abscisic acid mediated signaling; negative regulation of transcription, DNA-dependent

Research Articles on LANCL2

Similar Products

Product Notes

The LANCL2 lancl2 (Catalog #AAA642868) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LANCL2 (LanC-like Protein 2, Testis-specific Adriamycin Sensitivity Protein, GPR69B, TASP, MGC87139) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LANCL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the LANCL2 lancl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGETMSKRLK LHLGGEAEME ERAFVNPFPD YEAAAGALLA SGAAEETGCV RPPATTDEPG LPFHQDGKII HNFIRRIQTK IKDLLQQMEE GLKTADPHDC SAYTGWTGIA LLYLQLYRVT CDQTYLLRSL DYVKRTLRNL NGRRVTFLCG DAGPLAVGAV IYHKLRSDCE SQECVTKLLQ LQRSVVCQES DLPDELLYGR AGYLYALLYL NTEIGPGTVC ESAIKEVVNA IIESGKTLSR EERKTERCPL LYQWHRKQYV GAAHGMAGIY YMLMQPAAKV DQETLTEMVK PSIDYVRHKK FRSGNYPSSL SNETDRLVHW CHGAPGVIHM LMQAYKVFKE EKYLKEAMEC SDVIWQRGLL RKGYGICHGT AGNGYSFLSL YRLTQDKKYL YRACKFAEWC LDYGAHGCRI PDRPYSLFEG MAGAIHFLSD VLGPETSRFP AFELDSSKRD. It is sometimes possible for the material contained within the vial of "LANCL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.