Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C14ORF104 antibody (MBS5302515) used at 1 ug/ml to detect target protein.)

Rabbit C14ORF104 Polyclonal Antibody | anti-C14ORF104 antibody

C14ORF104 antibody

Gene Names
DNAAF2; KTU; PF13; CILD10; C14orf104
Applications
Western Blot
Purity
Affinity purified
Synonyms
C14ORF104; Polyclonal Antibody; C14ORF104 antibody; Polyclonal C14ORF104; Anti-C14ORF104; Chromosome ORF-14; Chromosome ORF 14; FLJ10563; Chromosome 14 ORF; anti-C14ORF104 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
C14ORF104 antibody was raised against the N terminal Of C14Orf104
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C14ORF104 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
404
Applicable Applications for anti-C14ORF104 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
This protein is highly conserved and involved in the preassembly of dynein arm complexes which power cilia. These complexes are found in some cilia and are assembled in the cytoplasm prior to transport for cilia formation. Mutations in this gene have been associated with primary ciliary dyskinesia. Multiple transcript variants encoding different isoforms have been found for this gene.
Cross-Reactivity
Human
Immunogen
C14ORF104 antibody was raised using the N terminal Of C14Orf104 corresponding to a region with amino acids MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(C14ORF104 antibody (MBS5302515) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (C14ORF104 antibody (MBS5302515) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C14ORF104 antibody
Rabbit polyclonal C14ORF104 antibody raised against the N terminal Of C14Orf104
Product Categories/Family for anti-C14ORF104 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
91 kDa (MW of target protein)
NCBI Official Full Name
C14orf104 protein, partial
NCBI Official Synonym Full Names
dynein, axonemal, assembly factor 2
NCBI Official Symbol
DNAAF2
NCBI Official Synonym Symbols
KTU; PF13; CILD10; C14orf104
NCBI Protein Information
protein kintoun
UniProt Protein Name
Protein kintoun
UniProt Gene Name
DNAAF2
UniProt Synonym Gene Names
C14orf104; KTU
UniProt Entry Name
KTU_HUMAN

NCBI Description

This gene encodes a highly conserved protein involved in the preassembly of dynein arm complexes which power cilia. These complexes are found in some cilia and are assembled in the cytoplasm prior to transport for cilia formation. Mutations in this gene have been associated with primary ciliary dyskinesia. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]

Uniprot Description

KTU: Required for cytoplasmic pre-assembly of axonemal dyneins, thereby playing a central role in motility in cilia and flagella. Involved in pre-assembly of dynein arm complexes in the cytoplasm before intraflagellar transport loads them for the ciliary compartment. Defects in DNAAF2 are the cause of primary ciliary dyskinesia type 10 (CILD10). CILD is an autosomal recessive disorder characterized by axonemal abnormalities of motile cilia. Respiratory infections leading to chronic inflammation and bronchiectasis are recurrent, due to defects in the respiratory cilia; reduced fertility is often observed in male patients due to abnormalities of sperm tails. Half of the patients exhibit situs inversus, due to dysfunction of monocilia at the embryonic node and randomization of left-right body asymmetry. Primary ciliary dyskinesia associated with situs inversus is referred to as Kartagener syndrome. Belongs to the PIH1 family. Kintoun subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 14q21.3

Cellular Component: cytoplasm

Molecular Function: protein binding

Biological Process: response to retinoic acid

Disease: Ciliary Dyskinesia, Primary, 10

Research Articles on C14ORF104

Similar Products

Product Notes

The C14ORF104 dnaaf2 (Catalog #AAA5302515) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C14ORF104 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C14ORF104 dnaaf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C14ORF104, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.