Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit Integrin Alpha 8 Polyclonal Antibody | anti-Itga8 antibody

Integrin Alpha 8 antibody

Gene Names
Itga8; AI447669
Applications
Western Blot
Purity
Affinity purified
Synonyms
Integrin Alpha 8; Polyclonal Antibody; Integrin Alpha 8 antibody; Polyclonal Integrin Alpha 8; Anti-Integrin Alpha 8; ITGA8; anti-Itga8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Integrin Alpha 8 antibody was raised against the N terminal of ITGA8
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ITGA8 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
1062
Applicable Applications for anti-Itga8 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Integrin alpha-8/beta-1 functions in the genesis of kidney and probably of other organs by regulating the recruitment of mesenchymal cells into epithelial structures.
Cross-Reactivity
Human
Immunogen
Integrin Alpha 8 antibody was raised using the N terminal of ITGA8 corresponding to a region with amino acids GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-Itga8 antibody
Rabbit polyclonal Integrin Alpha 8 antibody raised against the N terminal of ITGA8
Product Categories/Family for anti-Itga8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
117 kDa (MW of target protein)
NCBI Official Full Name
integrin alpha-8
NCBI Official Synonym Full Names
integrin alpha 8
NCBI Official Symbol
Itga8
NCBI Official Synonym Symbols
AI447669
NCBI Protein Information
integrin alpha-8
UniProt Protein Name
Integrin alpha-8
Protein Family
UniProt Gene Name
Itga8
UniProt Entry Name
ITA8_MOUSE

Uniprot Description

ITGA8: Integrin alpha-8/beta-1 functions in the genesis of kidney and probably of other organs by regulating the recruitment of mesenchymal cells into epithelial structures. It recognizes the sequence R-G-D in a wide array of ligands including TNC, FN1, SPP1 TGFB1, TGFB3 and VTN. NPNT is probably its functional ligand in kidney genesis. Neuronal receptor for TNC it mediates cell-cell interactions and regulates neurite outgrowth of sensory and motor neurons. Belongs to the integrin alpha chain family.

Protein type: Cell adhesion; Motility/polarity/chemotaxis; Membrane protein, integral

Cellular Component: focal adhesion; cell surface; membrane; apical part of cell; endoplasmic reticulum; postsynaptic density; integral to membrane; plasma membrane; perikaryon; integrin complex

Molecular Function: metal ion binding

Biological Process: integrin-mediated signaling pathway; nervous system development; extracellular matrix organization and biogenesis; inner ear morphogenesis; cell-matrix adhesion; multicellular organismal development; positive regulation of transforming growth factor beta receptor signaling pathway; memory; smooth muscle development; establishment of protein localization; cell projection organization and biogenesis; cell differentiation; cell adhesion; kidney development; metanephros development

Research Articles on Itga8

Similar Products

Product Notes

The Itga8 itga8 (Catalog #AAA5302198) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Integrin Alpha 8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the Itga8 itga8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Integrin Alpha 8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.