Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit Transportin 2 Polyclonal Antibody | anti-TNPO2 antibody

Transportin 2 antibody

Gene Names
TNPO2; IPO3; TRN2; KPNB2B
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
Transportin 2; Polyclonal Antibody; Transportin 2 antibody; Polyclonal Transportin 2; Anti-Transportin 2; KPNB2B; IPO3; FLJ12155; Importin 3 Karyopherin Beta 2B; Transportin -2; TRN2; TNPO2; anti-TNPO2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TNPO2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
887
Applicable Applications for anti-TNPO2 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Transportin-2 (TNPO2) mediates nuclear import of HuR protein in vitro. It also participates in mRNA export from the nucleus.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
Transportin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVQKTLAQAMMYTQHPEQYEAPDKDFMIVALDLLSGLAEGLGGHVEQLVA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-TNPO2 antibody
Rabbit polyclonal Transportin 2 antibody
Product Categories/Family for anti-TNPO2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
100 kDa (MW of target protein)
NCBI Official Full Name
Transportin 2
NCBI Official Synonym Full Names
transportin 2
NCBI Official Symbol
TNPO2
NCBI Official Synonym Symbols
IPO3; TRN2; KPNB2B
NCBI Protein Information
transportin-2
UniProt Protein Name
Transportin-2
Protein Family
UniProt Gene Name
TNPO2
UniProt Entry Name
TNPO2_HUMAN

Uniprot Description

TNPO2: Probably functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Belongs to the importin beta family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear import; Karyopherin

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; nuclear localization sequence binding; Ran GTPase binding

Biological Process: intracellular protein transport

Research Articles on TNPO2

Similar Products

Product Notes

The TNPO2 tnpo2 (Catalog #AAA5302102) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Transportin 2 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Transportin 2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TNPO2 tnpo2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Transportin 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.