Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HS3ST6 antibody (MBS5301806) used at 1 ug/ml to detect target protein.)

Rabbit HS3ST6 Polyclonal Antibody | anti-HS3ST6 antibody

HS3ST6 antibody

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish.
Applications
Western Blot
Purity
Affinity purified
Synonyms
HS3ST6; Polyclonal Antibody; HS3ST6 antibody; Polyclonal HS3ST6; Anti-HS3ST6; Heparan Sulfate; HS3ST5; Glucosamine 3-O-Sulfotransferase 6; anti-HS3ST6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish.
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Reconstitute with 50 ul distilled water for a final concentration of 1mg/ml in PBS buffer with 2% sucrose.
Concentration
50ug, lyophilized (varies by lot)
Sequence Length
332
Applicable Applications for anti-HS3ST6 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
HS3ST6 is a single-pass type II membrane protein. It belongs to the sulfotransferase 1 family. It transfers a sulfuryl group to heparan sulfate. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes Simplex Virus-1 (HSV-1) and permits its entry. Unlike 3-OST-1, does not convert non-anticoagulant heparan sulfate to anticoagulant heparan sulfate.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
Synthetic peptide directed towards the C terminal region of human HS3ST6
Immunogen Information
HS3ST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGGSRP
Preparation and Storage
Ships ambient or refrigerated. Upon receipt store at 4 degree C short term, -20 degree C long term. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(HS3ST6 antibody (MBS5301806) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (HS3ST6 antibody (MBS5301806) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-HS3ST6 antibody
Rabbit polyclonal HS3ST6 antibody
Product Categories/Family for anti-HS3ST6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
35 kDa (MW of target protein)
NCBI Official Full Name
Hs3st6 protein
NCBI Official Synonym Full Names
heparan sulfate (glucosamine) 3-O-sulfotransferase 6
NCBI Official Symbol
Hs3st6
NCBI Protein Information
heparan sulfate glucosamine 3-O-sulfotransferase 6
UniProt Protein Name
Heparan sulfate glucosamine 3-O-sulfotransferase 6
UniProt Gene Name
Hs3st6
UniProt Synonym Gene Names
3-OST-6; Heparan sulfate 3-O-sulfotransferase 6
UniProt Entry Name
HS3S6_MOUSE

Uniprot Description

HS3ST6: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to heparan sulfate. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes Simplex Virus-1 (HSV-1) and permits its entry. Unlike 3- OST-1, does not convert non-anticoagulant heparan sulfate to anticoagulant heparan sulfate. Belongs to the sulfotransferase 1 family.

Protein type: EC 2.8.2.23; Transferase; Membrane protein, integral

Cellular Component: Golgi apparatus; membrane; integral to membrane

Molecular Function: phenanthrol sulfotransferase activity; trans-3,4-dihydrodiolphenanthrene sulfotransferase activity; proteoglycan sulfotransferase activity; 2-phenanthrol sulfotransferase activity; galactose 3-O-sulfotransferase activity; transferase activity; 1-phenanthrol sulfotransferase activity; sulfotransferase activity; 3-phenanthrol sulfotransferase activity; HNK-1 sulfotransferase activity; N-acetylglucosamine 6-O-sulfotransferase activity; 4-phenanthrol sulfotransferase activity; trans-9R,10R-dihydrodiolphenanthrene sulfotransferase activity; heparan sulfate 2-O-sulfotransferase activity; cholesterol sulfotransferase activity; N-acetylgalactosamine 4-O-sulfotransferase activity; heparin-glucosamine 3-O-sulfotransferase activity; 9-phenanthrol sulfotransferase activity; heparan sulfate 6-O-sulfotransferase activity

Similar Products

Product Notes

The HS3ST6 hs3st6 (Catalog #AAA5301806) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HS3ST6 antibody reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish. and may cross-react with other species as described in the data sheet. AAA Biotech's HS3ST6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the HS3ST6 hs3st6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HS3ST6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.