Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit UNC84A Polyclonal Antibody | anti-UNC84A antibody

UNC84A antibody

Gene Names
SUN1; UNC84A
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
UNC84A; Polyclonal Antibody; UNC84A antibody; Polyclonal UNC84A; Anti-UNC84A; MGC176649; Unc-84 Homolog A; SUN1; KIAA0810; UNCA-84; UNCA 84; FLJ12407; anti-UNC84A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UNC84A antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
812
Applicable Applications for anti-UNC84A antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
This gene is a member of the unc-84 homolog family and encodes a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Several alternatively spliced transcript variants of this gene have been described; however, the full-length nature of some of these variants has not been determined.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
UNC84A antibody was raised using a synthetic peptide corresponding to a region with amino acids QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-UNC84A antibody
Rabbit polyclonal UNC84A antibody
Product Categories/Family for anti-UNC84A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
78 kDa (MW of target protein)
NCBI Official Full Name
UNC84A protein
NCBI Official Synonym Full Names
Sad1 and UNC84 domain containing 1
NCBI Official Symbol
SUN1
NCBI Official Synonym Symbols
UNC84A
NCBI Protein Information
SUN domain-containing protein 1
UniProt Protein Name
SUN domain-containing protein 1
UniProt Gene Name
SUN1
UniProt Synonym Gene Names
KIAA0810; UNC84A
UniProt Entry Name
SUN1_HUMAN

NCBI Description

This gene is a member of the unc-84 homolog family and encodes a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2010]

Uniprot Description

SUN1: Component of SUN-protein-containing multivariate complexes also called LINC complexes which link the nucleoskeleton and cytoskeleton by providing versatile outer nuclear membrane attachment sites for cytoskeletal filaments. Required for interkinetic nuclear migration (INM) and essential for nucleokinesis and centrosome-nucleus coupling during radial neuronal migration in the cerebral cortex and during glial migration. Anchors chromosome movement in the prophase of meiosis and is involved in selective gene expression of coding and non- coding RNAs needed for gametogenesis. Required for telomere attachment to nuclear envelope and gametogenesis. Helps to define the distribution of nuclear pore complexes (NPCs). 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7p22.3

Cellular Component: nuclear membrane; intracellular membrane-bound organelle; integral to nuclear inner membrane; nuclear envelope; acrosomal membrane

Molecular Function: protein binding; lamin binding

Biological Process: nuclear membrane organization and biogenesis

Research Articles on UNC84A

Similar Products

Product Notes

The UNC84A sun1 (Catalog #AAA5301556) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UNC84A antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UNC84A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the UNC84A sun1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UNC84A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.