Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C4ORF23 antibody (MBS5300985) used at 1 ug/ml to detect target protein.)

Rabbit anti-Human, Rat C4ORF23 Polyclonal Antibody | anti-C4ORF23 antibody

C4ORF23 antibody

Gene Names
TRMT44; TRM44; C4orf23; METTL19
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
C4ORF23; Polyclonal Antibody; C4ORF23 antibody; Polyclonal C4ORF23; Anti-C4ORF23; Chromosome ORF-4; Chromosome 4 ORF; FLJ35725; FLJ12891; Chromosome ORF 4; anti-C4ORF23 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Specificity
C4ORF23 antibody was raised against the N terminal Of C4Orf23
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C4ORF23 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
411
Applicable Applications for anti-C4ORF23 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of Chromosome 4 ORF protein is not widely studied, and is yet to be elucidated fully.
Cross-Reactivity
Human,Rat
Immunogen
C4ORF23 antibody was raised using the N terminal Of C4Orf23 corresponding to a region with amino acids LTPWIPVIAARSSYNCRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDFIK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(C4ORF23 antibody (MBS5300985) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (C4ORF23 antibody (MBS5300985) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C4ORF23 antibody
Rabbit polyclonal C4ORF23 antibody raised against the N terminal Of C4Orf23
Product Categories/Family for anti-C4ORF23 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
41 kDa (MW of target protein)
NCBI Official Full Name
C4orf23 protein
NCBI Official Synonym Full Names
tRNA methyltransferase 44 homolog (S. cerevisiae)
NCBI Official Symbol
TRMT44
NCBI Official Synonym Symbols
TRM44; C4orf23; METTL19
NCBI Protein Information
probable tRNA (uracil-O(2)-)-methyltransferase
UniProt Protein Name
Probable tRNA (uracil-O(2)-)-methyltransferase
UniProt Gene Name
TRMT44
UniProt Synonym Gene Names
C4orf23; METTL19
UniProt Entry Name
TRM44_HUMAN

NCBI Description

The protein encoded by this gene is a putative tRNA methyltransferase found in the cytoplasm. Defects in this gene may be a cause of partial epilepsy with pericentral spikes (PEPS), but that has not been proven definitively. [provided by RefSeq, May 2012]

Uniprot Description

TRMT44: Probable adenosyl-L-methionine (AdoMet)-dependent tRNA (uracil-O(2)-)-methyltransferase. Belongs to the TRM44 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.1.1.211; Methyltransferase

Chromosomal Location of Human Ortholog: 4p16.1

Cellular Component: cytoplasm

Molecular Function: methyltransferase activity; metal ion binding

Biological Process: methylation; tRNA processing

Research Articles on C4ORF23

Similar Products

Product Notes

The C4ORF23 trmt44 (Catalog #AAA5300985) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C4ORF23 antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C4ORF23 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C4ORF23 trmt44 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C4ORF23, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.